Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1CIT4

Protein Details
Accession A0A2I1CIT4   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
60-79HSPPISPDTKKRSKVKFKSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MKIPSQPLLAGHILLALRHLGSRCINYQSISLVNEWLSLMPHTTRSSEEHSLCSWLEMSHSPPISPDTKKRSKVKFKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.08
4 0.08
5 0.09
6 0.1
7 0.11
8 0.13
9 0.16
10 0.18
11 0.21
12 0.22
13 0.21
14 0.21
15 0.2
16 0.19
17 0.17
18 0.15
19 0.12
20 0.11
21 0.1
22 0.1
23 0.08
24 0.07
25 0.06
26 0.06
27 0.06
28 0.08
29 0.09
30 0.1
31 0.11
32 0.14
33 0.19
34 0.24
35 0.25
36 0.25
37 0.24
38 0.26
39 0.24
40 0.22
41 0.17
42 0.11
43 0.12
44 0.11
45 0.14
46 0.18
47 0.18
48 0.17
49 0.18
50 0.22
51 0.25
52 0.29
53 0.35
54 0.38
55 0.48
56 0.57
57 0.65
58 0.72
59 0.79