Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MFZ7

Protein Details
Accession B8MFZ7    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-25IKGVNCRKSLTKRPNIKQLLEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 13.166, nucl 7.5, cyto_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MNKHIKGVNCRKSLTKRPNIKQLLENASQAPARPMVSTQESWEPKLLKLLTTSRFPFQFIEYPKFYDAFMAITGYFIDEAWEYQEILLSFNPFLDHTLVSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.73
4 0.75
5 0.83
6 0.81
7 0.76
8 0.7
9 0.67
10 0.64
11 0.55
12 0.49
13 0.39
14 0.36
15 0.32
16 0.27
17 0.2
18 0.15
19 0.13
20 0.12
21 0.12
22 0.13
23 0.16
24 0.17
25 0.17
26 0.24
27 0.25
28 0.26
29 0.28
30 0.26
31 0.22
32 0.27
33 0.25
34 0.17
35 0.19
36 0.22
37 0.22
38 0.25
39 0.26
40 0.23
41 0.23
42 0.24
43 0.22
44 0.2
45 0.23
46 0.22
47 0.26
48 0.25
49 0.27
50 0.27
51 0.26
52 0.24
53 0.19
54 0.15
55 0.11
56 0.1
57 0.09
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.05
64 0.06
65 0.05
66 0.06
67 0.08
68 0.09
69 0.08
70 0.08
71 0.11
72 0.1
73 0.12
74 0.13
75 0.12
76 0.12
77 0.12
78 0.13
79 0.11
80 0.13
81 0.13