Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1BSE3

Protein Details
Accession A0A2I1BSE3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-29YSFPRIFKGRRGRTGPRKGCQHydrophilic
NLS Segment(s)
PositionSequence
17-24GRRGRTGP
Subcellular Location(s) mito 16, cyto 5.5, cyto_nucl 5.5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MSTTWRENYSFPRIFKGRRGRTGPRKGCQEEKRTLPRTPADVSAFSYVAVENPHPGAGMLTGFPFGTRRTRAPFKRNFPMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.55
3 0.59
4 0.59
5 0.62
6 0.68
7 0.7
8 0.76
9 0.84
10 0.83
11 0.78
12 0.79
13 0.74
14 0.76
15 0.74
16 0.7
17 0.65
18 0.65
19 0.67
20 0.63
21 0.6
22 0.54
23 0.48
24 0.45
25 0.4
26 0.36
27 0.28
28 0.24
29 0.25
30 0.22
31 0.2
32 0.16
33 0.14
34 0.1
35 0.09
36 0.1
37 0.08
38 0.07
39 0.08
40 0.08
41 0.07
42 0.07
43 0.07
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.08
52 0.09
53 0.15
54 0.19
55 0.24
56 0.31
57 0.42
58 0.51
59 0.6
60 0.68
61 0.71