Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1BZZ3

Protein Details
Accession A0A2I1BZZ3    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
32-53GMCRSRKPSKWLCQGCRWPQLPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Amino Acid Sequences MCGFSGFAAHLLSPGRYRLLRAGCMRRRITQGMCRSRKPSKWLCQGCRWPQLPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.14
4 0.16
5 0.21
6 0.23
7 0.28
8 0.33
9 0.42
10 0.44
11 0.52
12 0.53
13 0.5
14 0.51
15 0.49
16 0.46
17 0.44
18 0.49
19 0.51
20 0.54
21 0.55
22 0.57
23 0.61
24 0.62
25 0.63
26 0.63
27 0.63
28 0.69
29 0.75
30 0.75
31 0.78
32 0.82
33 0.82
34 0.82