Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1CA74

Protein Details
Accession A0A2I1CA74    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
127-159NPSLNRGRTPSCRKRHARRNGKRKPSPNAYEKMHydrophilic
NLS Segment(s)
PositionSequence
139-163RKRHARRNGKRKPSPNAYEKMPKVK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MSRTRQVPSNTASSSHIQLLSPAVPQENHSSVRISGTLRLRAENDSIATDQIEDATPGRHIRWTEDVVDNEGMGKKSSKGESSSESEDSTSSSSESESDNDVDCRDPIGRAQNHKQNAQDASQSPSNPSLNRGRTPSCRKRHARRNGKRKPSPNAYEKMPKVKGQPRNTGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.29
4 0.21
5 0.21
6 0.22
7 0.19
8 0.18
9 0.16
10 0.15
11 0.14
12 0.16
13 0.21
14 0.22
15 0.24
16 0.23
17 0.24
18 0.23
19 0.24
20 0.24
21 0.19
22 0.22
23 0.24
24 0.3
25 0.29
26 0.3
27 0.3
28 0.3
29 0.31
30 0.26
31 0.22
32 0.18
33 0.17
34 0.15
35 0.14
36 0.12
37 0.1
38 0.09
39 0.08
40 0.06
41 0.06
42 0.07
43 0.08
44 0.09
45 0.1
46 0.12
47 0.12
48 0.15
49 0.19
50 0.21
51 0.23
52 0.26
53 0.26
54 0.26
55 0.25
56 0.21
57 0.18
58 0.17
59 0.14
60 0.11
61 0.11
62 0.09
63 0.12
64 0.14
65 0.14
66 0.15
67 0.17
68 0.2
69 0.23
70 0.25
71 0.23
72 0.22
73 0.2
74 0.18
75 0.16
76 0.13
77 0.1
78 0.07
79 0.06
80 0.06
81 0.06
82 0.07
83 0.08
84 0.09
85 0.09
86 0.1
87 0.1
88 0.11
89 0.1
90 0.1
91 0.1
92 0.09
93 0.08
94 0.1
95 0.18
96 0.22
97 0.28
98 0.35
99 0.41
100 0.44
101 0.47
102 0.47
103 0.43
104 0.41
105 0.36
106 0.34
107 0.28
108 0.29
109 0.29
110 0.28
111 0.25
112 0.27
113 0.28
114 0.24
115 0.27
116 0.31
117 0.33
118 0.36
119 0.39
120 0.4
121 0.47
122 0.58
123 0.63
124 0.64
125 0.69
126 0.76
127 0.82
128 0.87
129 0.88
130 0.89
131 0.9
132 0.92
133 0.93
134 0.94
135 0.93
136 0.92
137 0.9
138 0.89
139 0.87
140 0.84
141 0.79
142 0.75
143 0.75
144 0.72
145 0.72
146 0.65
147 0.61
148 0.62
149 0.66
150 0.68
151 0.67