Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8LX24

Protein Details
Accession B8LX24    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
46-71DLRAAHEKEKQKRQKSKKQISHDQGIHydrophilic
NLS Segment(s)
PositionSequence
53-62KEKQKRQKSK
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
Amino Acid Sequences MTTTKKRISRHTRSLSEAIGEVFTRASKAYEMSINELTIAQKELHDLRAAHEKEKQKRQKSKKQISHDQGITREEAQALLQGQIEASQAVTTAPAEPELPVSHPPKLRFEFNIAYAFGEKLSARLPITLSYFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.64
3 0.55
4 0.45
5 0.35
6 0.26
7 0.21
8 0.14
9 0.11
10 0.1
11 0.09
12 0.09
13 0.09
14 0.08
15 0.09
16 0.11
17 0.14
18 0.16
19 0.2
20 0.2
21 0.19
22 0.19
23 0.18
24 0.16
25 0.13
26 0.13
27 0.09
28 0.08
29 0.11
30 0.11
31 0.12
32 0.14
33 0.14
34 0.14
35 0.24
36 0.25
37 0.24
38 0.29
39 0.36
40 0.42
41 0.52
42 0.59
43 0.59
44 0.69
45 0.78
46 0.82
47 0.85
48 0.88
49 0.86
50 0.86
51 0.86
52 0.81
53 0.78
54 0.7
55 0.62
56 0.53
57 0.45
58 0.37
59 0.27
60 0.22
61 0.15
62 0.12
63 0.09
64 0.09
65 0.08
66 0.08
67 0.07
68 0.07
69 0.06
70 0.07
71 0.07
72 0.05
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.06
82 0.06
83 0.07
84 0.09
85 0.09
86 0.11
87 0.15
88 0.18
89 0.23
90 0.28
91 0.3
92 0.36
93 0.39
94 0.41
95 0.39
96 0.43
97 0.41
98 0.39
99 0.4
100 0.33
101 0.31
102 0.27
103 0.25
104 0.18
105 0.16
106 0.13
107 0.11
108 0.12
109 0.14
110 0.13
111 0.15
112 0.16
113 0.18