Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1CPH4

Protein Details
Accession A0A2I1CPH4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MASKNRTIRKRKLNTPRAKCQQRIRRRDGLFHydrophilic
NLS Segment(s)
PositionSequence
9-14RKRKLN
Subcellular Location(s) nucl 12.5, mito_nucl 11.5, mito 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MASKNRTIRKRKLNTPRAKCQQRIRRRDGLFRKAFEYCCECDADIFLMIRLKHNGQIYMFNSDSRWPLMHEDMFFQYPRPKTITWQELAARYTNGTNHPGQQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.9
4 0.9
5 0.89
6 0.86
7 0.86
8 0.86
9 0.85
10 0.86
11 0.83
12 0.82
13 0.77
14 0.8
15 0.79
16 0.78
17 0.74
18 0.65
19 0.61
20 0.54
21 0.51
22 0.44
23 0.39
24 0.3
25 0.25
26 0.24
27 0.21
28 0.17
29 0.17
30 0.14
31 0.1
32 0.09
33 0.08
34 0.09
35 0.1
36 0.11
37 0.12
38 0.11
39 0.14
40 0.15
41 0.16
42 0.14
43 0.19
44 0.19
45 0.23
46 0.22
47 0.19
48 0.19
49 0.19
50 0.19
51 0.15
52 0.15
53 0.11
54 0.14
55 0.17
56 0.18
57 0.17
58 0.19
59 0.2
60 0.21
61 0.2
62 0.19
63 0.22
64 0.22
65 0.24
66 0.25
67 0.23
68 0.27
69 0.37
70 0.42
71 0.37
72 0.41
73 0.42
74 0.42
75 0.43
76 0.39
77 0.31
78 0.25
79 0.26
80 0.24
81 0.24
82 0.24
83 0.25