Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1BSJ2

Protein Details
Accession A0A2I1BSJ2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-34GSFQVRRRCGPHDKRRKSHRCENCQRSHIKCBasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MSLGSFQVRRRCGPHDKRRKSHRCENCQRSHIKCDGSRPCSACRSRTLRCDAVSSVESSSDLAIVVCQPPATVSPGIGGTSPQSHMRTGSGHRSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.7
3 0.77
4 0.83
5 0.9
6 0.92
7 0.9
8 0.89
9 0.89
10 0.89
11 0.89
12 0.89
13 0.87
14 0.83
15 0.82
16 0.76
17 0.71
18 0.65
19 0.59
20 0.51
21 0.52
22 0.53
23 0.51
24 0.5
25 0.47
26 0.45
27 0.47
28 0.47
29 0.4
30 0.39
31 0.42
32 0.41
33 0.44
34 0.47
35 0.42
36 0.41
37 0.4
38 0.33
39 0.3
40 0.27
41 0.22
42 0.16
43 0.13
44 0.12
45 0.1
46 0.1
47 0.06
48 0.05
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.07
58 0.11
59 0.1
60 0.1
61 0.11
62 0.12
63 0.13
64 0.12
65 0.11
66 0.1
67 0.12
68 0.14
69 0.18
70 0.19
71 0.19
72 0.21
73 0.22
74 0.24
75 0.28