Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1C1T1

Protein Details
Accession A0A2I1C1T1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
38-68GDKTLSDWQRKKKKEKRKERHMREYRKSAVVBasic
NLS Segment(s)
PositionSequence
47-61RKKKKEKRKERHMRE
Subcellular Location(s) nucl 15, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MIITRCLFTTLCTVELWPFKESLLVKLRQSISDPASRGDKTLSDWQRKKKKEKRKERHMREYRKSAVVVEVEEIREEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.26
4 0.2
5 0.19
6 0.17
7 0.22
8 0.22
9 0.24
10 0.27
11 0.27
12 0.26
13 0.32
14 0.34
15 0.3
16 0.32
17 0.29
18 0.25
19 0.26
20 0.27
21 0.22
22 0.25
23 0.24
24 0.22
25 0.18
26 0.16
27 0.15
28 0.24
29 0.29
30 0.35
31 0.41
32 0.51
33 0.6
34 0.67
35 0.74
36 0.75
37 0.79
38 0.81
39 0.87
40 0.88
41 0.9
42 0.94
43 0.93
44 0.95
45 0.94
46 0.94
47 0.92
48 0.9
49 0.84
50 0.77
51 0.67
52 0.57
53 0.51
54 0.42
55 0.34
56 0.27
57 0.24
58 0.2