Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1C5Z4

Protein Details
Accession A0A2I1C5Z4   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
89-132KRATYNPSRRVQKRRHGFLARLRSRGGRKVLQHRRAKGRKSLSWHydrophilic
NLS Segment(s)
PositionSequence
96-129SRRVQKRRHGFLARLRSRGGRKVLQHRRAKGRKS
Subcellular Location(s) mito 14, nucl 10, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLCFQCRAVPSALRTAMRSQPFSRLPTQTFTTSLSTPLRTFSSALRSQPTPLTQSLPSFRTSLTPVSSLSFGLTQQTRSFSASASLAGKRATYNPSRRVQKRRHGFLARLRSRGGRKVLQHRRAKGRKSLSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.41
4 0.41
5 0.43
6 0.37
7 0.41
8 0.44
9 0.46
10 0.47
11 0.44
12 0.42
13 0.42
14 0.44
15 0.37
16 0.35
17 0.33
18 0.31
19 0.26
20 0.27
21 0.25
22 0.23
23 0.22
24 0.22
25 0.21
26 0.19
27 0.19
28 0.17
29 0.23
30 0.24
31 0.25
32 0.27
33 0.25
34 0.26
35 0.28
36 0.27
37 0.23
38 0.2
39 0.22
40 0.19
41 0.21
42 0.23
43 0.22
44 0.21
45 0.19
46 0.18
47 0.17
48 0.17
49 0.16
50 0.14
51 0.14
52 0.13
53 0.13
54 0.13
55 0.12
56 0.1
57 0.09
58 0.07
59 0.09
60 0.09
61 0.1
62 0.1
63 0.13
64 0.13
65 0.14
66 0.14
67 0.12
68 0.13
69 0.12
70 0.13
71 0.13
72 0.12
73 0.12
74 0.12
75 0.12
76 0.11
77 0.14
78 0.17
79 0.23
80 0.31
81 0.37
82 0.46
83 0.55
84 0.63
85 0.7
86 0.74
87 0.77
88 0.8
89 0.8
90 0.82
91 0.78
92 0.77
93 0.76
94 0.78
95 0.73
96 0.66
97 0.6
98 0.57
99 0.56
100 0.57
101 0.54
102 0.5
103 0.53
104 0.61
105 0.7
106 0.73
107 0.77
108 0.78
109 0.83
110 0.85
111 0.83
112 0.82