Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MNK1

Protein Details
Accession B8MNK1    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
43-67VDPPLKPQKKTQKRWLDSLCRHKKSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8.5, cyto_nucl 6.5, mito 4, nucl 3.5, extr 3, pero 3, plas 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003673  CoA-Trfase_fam_III  
IPR044855  CoA-Trfase_III_dom3_sf  
IPR023606  CoA-Trfase_III_dom_1_sf  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF02515  CoA_transf_3  
Amino Acid Sequences MASDDTIRQPPLAGLKVLELEGIAMAPFTGMVLADLGCDVVRVDPPLKPQKKTQKRWLDSLCRHKKSIIVDFEVTASRQAFLRLLEAADILIDSYRPGIFDRMIGMNADELCRRYPRLIYARVTGYSRYDARYAHAMGHENNFVAVSGAIPALQHVPPTNSNSNHNSTLSKPTVNYLADFGGGSMSCVVGILAAVIHRSASGKGQIVDASVQQSTSYLATFPLQRRHGQPDNEPSLTGVNNAPWSDIYETSDGKYMMVSSIEDALYERLIRGLGIEPASVPSRTDRGNWPAIRGLLTDRFASQSQDYWRSVFDKMPACVSPVLDVDDVDVHQPLVYLSRTPSLPTIAESMVSENKIPELVSGRGNEEVVRRWLRADDICTDDGSCIRVVSKSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.24
4 0.23
5 0.2
6 0.13
7 0.1
8 0.09
9 0.09
10 0.06
11 0.04
12 0.04
13 0.04
14 0.04
15 0.03
16 0.03
17 0.03
18 0.04
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.06
28 0.08
29 0.11
30 0.13
31 0.15
32 0.24
33 0.35
34 0.41
35 0.43
36 0.52
37 0.6
38 0.69
39 0.77
40 0.79
41 0.79
42 0.78
43 0.85
44 0.85
45 0.84
46 0.83
47 0.85
48 0.85
49 0.78
50 0.75
51 0.66
52 0.6
53 0.57
54 0.56
55 0.51
56 0.46
57 0.42
58 0.41
59 0.41
60 0.38
61 0.31
62 0.24
63 0.18
64 0.13
65 0.12
66 0.13
67 0.13
68 0.12
69 0.13
70 0.12
71 0.11
72 0.11
73 0.11
74 0.09
75 0.08
76 0.07
77 0.05
78 0.04
79 0.04
80 0.04
81 0.05
82 0.05
83 0.06
84 0.07
85 0.1
86 0.1
87 0.11
88 0.14
89 0.14
90 0.14
91 0.14
92 0.13
93 0.13
94 0.13
95 0.13
96 0.11
97 0.11
98 0.13
99 0.15
100 0.16
101 0.17
102 0.18
103 0.25
104 0.32
105 0.37
106 0.38
107 0.4
108 0.41
109 0.41
110 0.4
111 0.33
112 0.28
113 0.25
114 0.24
115 0.22
116 0.21
117 0.19
118 0.2
119 0.23
120 0.22
121 0.2
122 0.21
123 0.21
124 0.21
125 0.23
126 0.21
127 0.17
128 0.16
129 0.14
130 0.11
131 0.09
132 0.07
133 0.05
134 0.04
135 0.04
136 0.04
137 0.04
138 0.05
139 0.07
140 0.07
141 0.07
142 0.08
143 0.11
144 0.13
145 0.19
146 0.24
147 0.23
148 0.28
149 0.31
150 0.35
151 0.34
152 0.33
153 0.29
154 0.26
155 0.31
156 0.28
157 0.25
158 0.21
159 0.2
160 0.23
161 0.22
162 0.2
163 0.14
164 0.13
165 0.12
166 0.12
167 0.1
168 0.07
169 0.06
170 0.06
171 0.04
172 0.04
173 0.03
174 0.03
175 0.03
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.03
182 0.03
183 0.03
184 0.03
185 0.04
186 0.04
187 0.06
188 0.08
189 0.09
190 0.1
191 0.11
192 0.11
193 0.1
194 0.11
195 0.1
196 0.09
197 0.08
198 0.07
199 0.07
200 0.07
201 0.07
202 0.07
203 0.06
204 0.05
205 0.06
206 0.07
207 0.11
208 0.14
209 0.21
210 0.23
211 0.26
212 0.29
213 0.37
214 0.42
215 0.41
216 0.44
217 0.45
218 0.48
219 0.46
220 0.42
221 0.35
222 0.3
223 0.27
224 0.22
225 0.14
226 0.09
227 0.11
228 0.11
229 0.11
230 0.09
231 0.11
232 0.12
233 0.12
234 0.13
235 0.13
236 0.14
237 0.14
238 0.17
239 0.15
240 0.13
241 0.12
242 0.1
243 0.08
244 0.08
245 0.08
246 0.06
247 0.08
248 0.08
249 0.08
250 0.08
251 0.08
252 0.08
253 0.08
254 0.07
255 0.06
256 0.06
257 0.06
258 0.07
259 0.07
260 0.09
261 0.1
262 0.1
263 0.09
264 0.11
265 0.13
266 0.12
267 0.12
268 0.11
269 0.14
270 0.15
271 0.18
272 0.22
273 0.26
274 0.35
275 0.35
276 0.36
277 0.36
278 0.36
279 0.34
280 0.29
281 0.27
282 0.23
283 0.23
284 0.21
285 0.19
286 0.21
287 0.21
288 0.23
289 0.2
290 0.2
291 0.24
292 0.29
293 0.29
294 0.27
295 0.29
296 0.28
297 0.29
298 0.26
299 0.27
300 0.27
301 0.27
302 0.3
303 0.28
304 0.28
305 0.28
306 0.26
307 0.22
308 0.17
309 0.19
310 0.16
311 0.15
312 0.13
313 0.13
314 0.13
315 0.12
316 0.11
317 0.08
318 0.08
319 0.08
320 0.07
321 0.09
322 0.1
323 0.1
324 0.12
325 0.16
326 0.16
327 0.18
328 0.19
329 0.19
330 0.19
331 0.19
332 0.21
333 0.18
334 0.18
335 0.17
336 0.19
337 0.2
338 0.2
339 0.19
340 0.16
341 0.16
342 0.16
343 0.15
344 0.14
345 0.15
346 0.17
347 0.2
348 0.21
349 0.23
350 0.24
351 0.24
352 0.24
353 0.23
354 0.25
355 0.29
356 0.31
357 0.29
358 0.3
359 0.31
360 0.35
361 0.36
362 0.35
363 0.32
364 0.34
365 0.35
366 0.34
367 0.33
368 0.28
369 0.24
370 0.22
371 0.17
372 0.12
373 0.13
374 0.16