Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FZN9

Protein Details
Accession A0A2I2FZN9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
71-96YQIAMIMRKNRDRRKQKPKDEEPAPAHydrophilic
NLS Segment(s)
PositionSequence
79-89KNRDRRKQKPK
Subcellular Location(s) nucl 10, cyto 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MKDLPRKKSKESLFACFPEFSSDDEQDVSQEILNFCNQNSDVMSNLSIKKNRGIARTQMEEFRSQVVEVLYQIAMIMRKNRDRRKQKPKDEEPAPAAGSAAPVPLLPSHPSLPAAAGAGLAASGLTQYTSMFPAAAATNPSTVTFPARLTTSGTIQQPAPQLNPSNYFADYPVWIYRGEMVIKSFPLRSFLGEGATRSPWTTELGIPQLRRTDLSFARCLDILRAQCGFHPTTEVLKGLIGVVTFTMERVELEDESRWLQALNDGFNGGMYPLYIEGRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.61
3 0.52
4 0.45
5 0.39
6 0.35
7 0.3
8 0.29
9 0.27
10 0.25
11 0.25
12 0.24
13 0.2
14 0.2
15 0.17
16 0.12
17 0.14
18 0.14
19 0.14
20 0.17
21 0.17
22 0.15
23 0.2
24 0.19
25 0.17
26 0.19
27 0.18
28 0.17
29 0.17
30 0.19
31 0.18
32 0.22
33 0.27
34 0.28
35 0.29
36 0.32
37 0.38
38 0.41
39 0.42
40 0.43
41 0.44
42 0.48
43 0.52
44 0.49
45 0.47
46 0.44
47 0.42
48 0.38
49 0.32
50 0.26
51 0.2
52 0.2
53 0.15
54 0.14
55 0.12
56 0.13
57 0.1
58 0.09
59 0.09
60 0.08
61 0.09
62 0.09
63 0.15
64 0.18
65 0.26
66 0.36
67 0.46
68 0.55
69 0.65
70 0.74
71 0.81
72 0.86
73 0.89
74 0.91
75 0.91
76 0.9
77 0.84
78 0.79
79 0.7
80 0.63
81 0.52
82 0.41
83 0.32
84 0.22
85 0.18
86 0.12
87 0.09
88 0.05
89 0.05
90 0.05
91 0.05
92 0.07
93 0.08
94 0.1
95 0.11
96 0.12
97 0.13
98 0.12
99 0.12
100 0.11
101 0.1
102 0.07
103 0.06
104 0.05
105 0.04
106 0.04
107 0.03
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.03
115 0.04
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.06
122 0.06
123 0.07
124 0.07
125 0.07
126 0.07
127 0.08
128 0.07
129 0.07
130 0.09
131 0.09
132 0.08
133 0.09
134 0.1
135 0.1
136 0.11
137 0.12
138 0.13
139 0.16
140 0.16
141 0.16
142 0.16
143 0.18
144 0.18
145 0.18
146 0.17
147 0.15
148 0.17
149 0.18
150 0.21
151 0.21
152 0.2
153 0.2
154 0.19
155 0.18
156 0.16
157 0.15
158 0.14
159 0.12
160 0.11
161 0.11
162 0.1
163 0.11
164 0.12
165 0.12
166 0.11
167 0.12
168 0.12
169 0.13
170 0.14
171 0.14
172 0.12
173 0.15
174 0.15
175 0.15
176 0.16
177 0.16
178 0.18
179 0.17
180 0.18
181 0.17
182 0.17
183 0.16
184 0.14
185 0.14
186 0.12
187 0.13
188 0.14
189 0.13
190 0.15
191 0.2
192 0.24
193 0.24
194 0.25
195 0.26
196 0.25
197 0.25
198 0.24
199 0.25
200 0.26
201 0.31
202 0.32
203 0.3
204 0.31
205 0.31
206 0.29
207 0.25
208 0.26
209 0.22
210 0.22
211 0.22
212 0.2
213 0.21
214 0.25
215 0.24
216 0.18
217 0.2
218 0.19
219 0.21
220 0.23
221 0.21
222 0.17
223 0.16
224 0.16
225 0.13
226 0.12
227 0.08
228 0.07
229 0.06
230 0.07
231 0.07
232 0.07
233 0.07
234 0.06
235 0.07
236 0.09
237 0.11
238 0.11
239 0.13
240 0.15
241 0.16
242 0.17
243 0.18
244 0.16
245 0.13
246 0.13
247 0.16
248 0.17
249 0.18
250 0.17
251 0.17
252 0.17
253 0.16
254 0.16
255 0.11
256 0.08
257 0.06
258 0.06
259 0.07