Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2G7L1

Protein Details
Accession A0A2I2G7L1   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-39APVPSGKGRKPPPHEHRRPAFBasic
NLS Segment(s)
PositionSequence
24-36GKGRKPPPHEHRR
Subcellular Location(s) mito 13, nucl 8, cyto_nucl 7.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MRRDQRNLRNLRVQNPRDAPVPSGKGRKPPPHEHRRPAFGLRSAAALLDLIHSSVDSRLFSHLASVCLPTLPRLCLRASSRFVPGFLPST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.64
3 0.59
4 0.52
5 0.49
6 0.42
7 0.39
8 0.41
9 0.37
10 0.41
11 0.4
12 0.46
13 0.52
14 0.59
15 0.6
16 0.65
17 0.7
18 0.74
19 0.81
20 0.81
21 0.79
22 0.75
23 0.71
24 0.64
25 0.57
26 0.49
27 0.42
28 0.33
29 0.28
30 0.22
31 0.18
32 0.13
33 0.1
34 0.06
35 0.05
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.06
43 0.06
44 0.07
45 0.09
46 0.09
47 0.09
48 0.13
49 0.13
50 0.14
51 0.14
52 0.15
53 0.13
54 0.14
55 0.14
56 0.13
57 0.14
58 0.15
59 0.17
60 0.18
61 0.19
62 0.25
63 0.3
64 0.35
65 0.38
66 0.38
67 0.43
68 0.42
69 0.42
70 0.37