Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2FVF0

Protein Details
Accession A0A2I2FVF0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAPARKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
5-12RKKWSKGK
Subcellular Location(s) mito 11, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPARKKWSKGKVKDKAQHAVVLEKQTAERLNKDVQSYRLITVATLVDRLKINGSLARKALADLEEKGQIKKVVGHSKMNIYSMLHQYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.82
4 0.74
5 0.67
6 0.57
7 0.52
8 0.45
9 0.41
10 0.34
11 0.26
12 0.24
13 0.22
14 0.25
15 0.21
16 0.2
17 0.2
18 0.23
19 0.25
20 0.27
21 0.28
22 0.26
23 0.28
24 0.27
25 0.24
26 0.21
27 0.19
28 0.16
29 0.14
30 0.13
31 0.09
32 0.09
33 0.08
34 0.09
35 0.09
36 0.09
37 0.09
38 0.09
39 0.1
40 0.12
41 0.14
42 0.15
43 0.15
44 0.16
45 0.15
46 0.15
47 0.16
48 0.14
49 0.14
50 0.13
51 0.15
52 0.19
53 0.2
54 0.21
55 0.22
56 0.22
57 0.2
58 0.24
59 0.31
60 0.35
61 0.38
62 0.44
63 0.44
64 0.5
65 0.52
66 0.48
67 0.41
68 0.34
69 0.35