Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2GSN9

Protein Details
Accession A0A2I2GSN9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
14-41WKIPWRISSPQKARQRKRLRSVDRVVDTHydrophilic
73-102DKYTIFDKKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
80-94KKEKKYRKGIHKLPK
Subcellular Location(s) mito 25, mito_nucl 13.833, cyto_mito 13.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPSSPLFSGLLWKIPWRISSPQKARQRKRLRSVDRVVDTVSAALQRNGETTKMVERWYKEMPREEEMLPKDKYTIFDKKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.26
4 0.26
5 0.25
6 0.32
7 0.36
8 0.46
9 0.52
10 0.59
11 0.67
12 0.76
13 0.79
14 0.83
15 0.85
16 0.85
17 0.87
18 0.88
19 0.86
20 0.84
21 0.83
22 0.81
23 0.72
24 0.63
25 0.54
26 0.43
27 0.35
28 0.25
29 0.19
30 0.12
31 0.1
32 0.09
33 0.09
34 0.08
35 0.09
36 0.1
37 0.1
38 0.08
39 0.09
40 0.11
41 0.12
42 0.14
43 0.15
44 0.16
45 0.2
46 0.25
47 0.28
48 0.28
49 0.34
50 0.36
51 0.36
52 0.38
53 0.34
54 0.35
55 0.34
56 0.36
57 0.3
58 0.27
59 0.26
60 0.24
61 0.26
62 0.26
63 0.32
64 0.3
65 0.39
66 0.47
67 0.55
68 0.64
69 0.7
70 0.71
71 0.73
72 0.79
73 0.8
74 0.84
75 0.85
76 0.86
77 0.85
78 0.89
79 0.88
80 0.88
81 0.83
82 0.8
83 0.8
84 0.8
85 0.8
86 0.77
87 0.79