Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MUS8

Protein Details
Accession B8MUS8    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
98-119PSQWRHAKIIPLKKPNKKDYTIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, nucl 11.5, cyto 11.5, mito 2
Family & Domain DBs
Amino Acid Sequences DIAFRKVPQLKRIDGTTTTNHKEQAEELLAKFFPPLPDDIDDEGSRPQRAPIEMPAITLEEAPGEDGLLVIVWKMTWPAVKHRVLNLFSTSLEEGTLPSQWRHAKIIPLKKPNKKDYTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.45
4 0.46
5 0.46
6 0.43
7 0.43
8 0.39
9 0.36
10 0.32
11 0.3
12 0.27
13 0.24
14 0.23
15 0.22
16 0.22
17 0.21
18 0.2
19 0.16
20 0.12
21 0.12
22 0.13
23 0.13
24 0.15
25 0.18
26 0.19
27 0.2
28 0.19
29 0.19
30 0.21
31 0.2
32 0.18
33 0.16
34 0.15
35 0.14
36 0.15
37 0.16
38 0.16
39 0.19
40 0.19
41 0.19
42 0.18
43 0.16
44 0.15
45 0.13
46 0.1
47 0.05
48 0.05
49 0.05
50 0.04
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.02
58 0.02
59 0.02
60 0.02
61 0.03
62 0.04
63 0.07
64 0.09
65 0.16
66 0.24
67 0.28
68 0.3
69 0.35
70 0.41
71 0.39
72 0.41
73 0.36
74 0.29
75 0.26
76 0.27
77 0.23
78 0.16
79 0.14
80 0.12
81 0.1
82 0.1
83 0.13
84 0.12
85 0.11
86 0.18
87 0.22
88 0.25
89 0.29
90 0.31
91 0.37
92 0.44
93 0.55
94 0.58
95 0.65
96 0.72
97 0.77
98 0.84
99 0.85