Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2GIM8

Protein Details
Accession A0A2I2GIM8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-116LDEEHKKEKEEKKHQKSLAHBasic
NLS Segment(s)
PositionSequence
102-131KKEKEEKKHQKSLAHEGLADKLKHKLLGRK
Subcellular Location(s) cyto_nucl 13, nucl 12, cyto 10, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MGEHEPVVSHGRGGQGNIGADSTPYVDGGIVREGAYGDQGDGAYSAGRGGAGNIGSPHVRPTSRQPHDAEVVPELAIRNSGEGDYHVGRGGQGNVHLDEEHKKEKEEKKHQKSLAHEGLADKLKHKLLGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.19
4 0.19
5 0.17
6 0.13
7 0.12
8 0.12
9 0.1
10 0.08
11 0.07
12 0.07
13 0.07
14 0.07
15 0.08
16 0.09
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.09
23 0.07
24 0.06
25 0.06
26 0.06
27 0.06
28 0.05
29 0.06
30 0.05
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.05
40 0.06
41 0.07
42 0.07
43 0.07
44 0.09
45 0.1
46 0.1
47 0.11
48 0.19
49 0.29
50 0.32
51 0.37
52 0.36
53 0.38
54 0.4
55 0.39
56 0.32
57 0.22
58 0.19
59 0.15
60 0.13
61 0.1
62 0.08
63 0.07
64 0.06
65 0.06
66 0.06
67 0.06
68 0.05
69 0.06
70 0.09
71 0.09
72 0.1
73 0.1
74 0.09
75 0.1
76 0.11
77 0.11
78 0.09
79 0.1
80 0.11
81 0.12
82 0.13
83 0.13
84 0.13
85 0.17
86 0.21
87 0.26
88 0.25
89 0.26
90 0.34
91 0.43
92 0.52
93 0.59
94 0.65
95 0.68
96 0.77
97 0.81
98 0.79
99 0.77
100 0.76
101 0.73
102 0.63
103 0.55
104 0.47
105 0.48
106 0.47
107 0.41
108 0.32
109 0.29
110 0.3
111 0.33