Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2FTJ8

Protein Details
Accession A0A2I2FTJ8    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-29YRPEISCRRHLLRRPKAQGRLPTRPLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MDGYRPEISCRRHLLRRPKAQGRLPTRPLMLGFRGCNTTWDWDGPLLSSVTIIPYFCPPTGLRIPNLYGYMEGSVNGTNPPSPSSCMSVPILRGPESSETEIEIEVVSYWSYRQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.72
3 0.79
4 0.81
5 0.83
6 0.84
7 0.83
8 0.83
9 0.81
10 0.8
11 0.74
12 0.68
13 0.6
14 0.53
15 0.47
16 0.41
17 0.35
18 0.29
19 0.26
20 0.23
21 0.25
22 0.23
23 0.23
24 0.21
25 0.21
26 0.18
27 0.18
28 0.17
29 0.14
30 0.14
31 0.13
32 0.12
33 0.09
34 0.07
35 0.07
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.09
43 0.09
44 0.11
45 0.1
46 0.15
47 0.21
48 0.21
49 0.21
50 0.21
51 0.22
52 0.22
53 0.23
54 0.18
55 0.12
56 0.11
57 0.12
58 0.1
59 0.08
60 0.08
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.08
67 0.1
68 0.1
69 0.13
70 0.14
71 0.18
72 0.18
73 0.21
74 0.22
75 0.23
76 0.23
77 0.24
78 0.25
79 0.22
80 0.21
81 0.21
82 0.23
83 0.25
84 0.26
85 0.22
86 0.21
87 0.21
88 0.21
89 0.19
90 0.14
91 0.1
92 0.08
93 0.08
94 0.07
95 0.07