Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2GM76

Protein Details
Accession A0A2I2GM76   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MLLTKKHHRPRIVNKGRREYLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, cyto_mito 7.333, E.R. 4, plas 3, cyto_nucl 2.333, cyto 2, pero 2, golg 2
Family & Domain DBs
Amino Acid Sequences MLLTKKHHRPRIVNKGRREYLSFVNQGSVCWFLPCWIRLCGCTYPVARNGNEADRYRSRIPYFDNKPHFFASILCLVFLESSPAIDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.82
4 0.76
5 0.68
6 0.61
7 0.57
8 0.55
9 0.48
10 0.38
11 0.37
12 0.33
13 0.29
14 0.27
15 0.22
16 0.15
17 0.13
18 0.12
19 0.1
20 0.13
21 0.14
22 0.15
23 0.15
24 0.15
25 0.16
26 0.2
27 0.2
28 0.17
29 0.2
30 0.18
31 0.19
32 0.23
33 0.26
34 0.22
35 0.23
36 0.24
37 0.24
38 0.28
39 0.27
40 0.28
41 0.27
42 0.33
43 0.33
44 0.37
45 0.34
46 0.32
47 0.37
48 0.41
49 0.46
50 0.5
51 0.56
52 0.54
53 0.56
54 0.55
55 0.5
56 0.4
57 0.33
58 0.28
59 0.26
60 0.23
61 0.19
62 0.17
63 0.17
64 0.17
65 0.16
66 0.16
67 0.09