Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2G4N6

Protein Details
Accession A0A2I2G4N6    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
42-67LNIWHLKKKYLTKAKKYKKIVSKALFHydrophilic
NLS Segment(s)
PositionSequence
49-61KKYLTKAKKYKKI
Subcellular Location(s) mito 17.5, mito_nucl 13.166, nucl 7.5, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences SASIYNKVNNKASPDHPSTPSLFKYYLILKGGRSSAVKVLPLNIWHLKKKYLTKAKKYKKIVSKALFLRAKNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.44
4 0.45
5 0.43
6 0.41
7 0.39
8 0.34
9 0.28
10 0.24
11 0.23
12 0.23
13 0.24
14 0.22
15 0.2
16 0.18
17 0.19
18 0.2
19 0.19
20 0.17
21 0.14
22 0.15
23 0.15
24 0.15
25 0.13
26 0.14
27 0.13
28 0.13
29 0.17
30 0.2
31 0.22
32 0.25
33 0.27
34 0.29
35 0.34
36 0.41
37 0.47
38 0.52
39 0.59
40 0.65
41 0.75
42 0.82
43 0.86
44 0.87
45 0.86
46 0.85
47 0.85
48 0.85
49 0.79
50 0.78
51 0.73
52 0.74
53 0.71