Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2GET8

Protein Details
Accession A0A2I2GET8   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
136-161EEGRLQERRRRNKLASRRLRQKHLDHBasic
NLS Segment(s)
PositionSequence
142-155ERRRRNKLASRRLR
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14686  bZIP  
Amino Acid Sequences MADITVMGGSLPQSPELWADFMYSDYPYHAATACGLSPLTSSPHDALTDQRPDDPLAVGLDPLLVPVTSLPDLDLSAGGLIPSMMAPMLPPEINDSHSSFSQSAAFPSSKARRRGWLSPGAEESGGDDRSLSPAGEEGRLQERRRRNKLASRRLRQKHLDHVADLESRLEAMTQERDGLRLRVAKWEGEAMALRKLLENRTNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.15
4 0.15
5 0.12
6 0.13
7 0.12
8 0.12
9 0.13
10 0.12
11 0.11
12 0.11
13 0.12
14 0.11
15 0.12
16 0.11
17 0.1
18 0.1
19 0.12
20 0.11
21 0.11
22 0.1
23 0.09
24 0.09
25 0.1
26 0.12
27 0.11
28 0.14
29 0.14
30 0.15
31 0.16
32 0.16
33 0.19
34 0.22
35 0.27
36 0.25
37 0.25
38 0.25
39 0.25
40 0.25
41 0.22
42 0.16
43 0.12
44 0.12
45 0.1
46 0.09
47 0.08
48 0.07
49 0.06
50 0.05
51 0.04
52 0.04
53 0.04
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.05
63 0.04
64 0.04
65 0.04
66 0.03
67 0.03
68 0.03
69 0.03
70 0.02
71 0.02
72 0.02
73 0.02
74 0.03
75 0.05
76 0.05
77 0.05
78 0.08
79 0.09
80 0.11
81 0.13
82 0.13
83 0.14
84 0.14
85 0.16
86 0.13
87 0.13
88 0.13
89 0.12
90 0.11
91 0.12
92 0.12
93 0.1
94 0.16
95 0.23
96 0.28
97 0.33
98 0.34
99 0.39
100 0.44
101 0.49
102 0.48
103 0.49
104 0.45
105 0.41
106 0.41
107 0.35
108 0.3
109 0.25
110 0.21
111 0.15
112 0.14
113 0.11
114 0.1
115 0.09
116 0.11
117 0.11
118 0.09
119 0.06
120 0.08
121 0.09
122 0.1
123 0.1
124 0.11
125 0.18
126 0.23
127 0.25
128 0.31
129 0.39
130 0.49
131 0.57
132 0.63
133 0.63
134 0.68
135 0.77
136 0.81
137 0.82
138 0.83
139 0.85
140 0.84
141 0.85
142 0.83
143 0.78
144 0.77
145 0.76
146 0.68
147 0.58
148 0.54
149 0.48
150 0.41
151 0.36
152 0.25
153 0.16
154 0.13
155 0.12
156 0.1
157 0.07
158 0.09
159 0.12
160 0.12
161 0.15
162 0.15
163 0.17
164 0.19
165 0.2
166 0.22
167 0.24
168 0.24
169 0.3
170 0.32
171 0.31
172 0.31
173 0.33
174 0.28
175 0.26
176 0.29
177 0.22
178 0.24
179 0.23
180 0.22
181 0.23
182 0.26
183 0.3