Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2GBQ3

Protein Details
Accession A0A2I2GBQ3   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-76IGGKTKDKGRTERRNRKPKRKRMPISDATLTBasic
NLS Segment(s)
PositionSequence
38-39RK
44-67GQIGGKTKDKGRTERRNRKPKRKR
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MARRGDSVAVKLAGNPWERRTSDSNGPQKWEREKGIERKVPDEGQIGGKTKDKGRTERRNRKPKRKRMPISDATLTTPTPPPPRPANPNRWC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.27
4 0.33
5 0.34
6 0.38
7 0.39
8 0.4
9 0.44
10 0.51
11 0.56
12 0.51
13 0.55
14 0.54
15 0.55
16 0.54
17 0.51
18 0.43
19 0.42
20 0.47
21 0.51
22 0.57
23 0.55
24 0.51
25 0.47
26 0.48
27 0.42
28 0.36
29 0.28
30 0.2
31 0.19
32 0.2
33 0.19
34 0.17
35 0.19
36 0.19
37 0.21
38 0.28
39 0.28
40 0.36
41 0.45
42 0.54
43 0.63
44 0.72
45 0.8
46 0.83
47 0.9
48 0.93
49 0.93
50 0.93
51 0.93
52 0.94
53 0.92
54 0.91
55 0.91
56 0.87
57 0.84
58 0.78
59 0.68
60 0.6
61 0.52
62 0.42
63 0.35
64 0.3
65 0.27
66 0.29
67 0.3
68 0.33
69 0.39
70 0.47
71 0.55
72 0.62