Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2FVZ2

Protein Details
Accession A0A2I2FVZ2    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-52LSPPARKPATRKDRRITRKGKELQRKHLREBasic
NLS Segment(s)
PositionSequence
26-49PARKPATRKDRRITRKGKELQRKH
Subcellular Location(s) plas 16, mito 4, cyto 2, golg 2, nucl 1, pero 1, E.R. 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSLRSTLSIPTDDTDNSGPALSLSPPARKPATRKDRRITRKGKELQRKHLRENQTVVRWMPDGNGFLVSKAFNVRVLGMDRMLTVTVPVSWRGVGGVVVLGAVVLGYLGFGRGFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.16
4 0.15
5 0.13
6 0.11
7 0.12
8 0.09
9 0.13
10 0.15
11 0.2
12 0.21
13 0.26
14 0.29
15 0.31
16 0.37
17 0.43
18 0.52
19 0.57
20 0.65
21 0.7
22 0.77
23 0.83
24 0.87
25 0.85
26 0.81
27 0.82
28 0.81
29 0.81
30 0.81
31 0.79
32 0.8
33 0.81
34 0.79
35 0.74
36 0.73
37 0.7
38 0.63
39 0.61
40 0.56
41 0.48
42 0.45
43 0.39
44 0.32
45 0.26
46 0.22
47 0.18
48 0.14
49 0.11
50 0.09
51 0.11
52 0.1
53 0.1
54 0.11
55 0.1
56 0.09
57 0.09
58 0.09
59 0.08
60 0.09
61 0.09
62 0.1
63 0.13
64 0.13
65 0.12
66 0.12
67 0.11
68 0.11
69 0.1
70 0.08
71 0.06
72 0.06
73 0.07
74 0.08
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.08
82 0.07
83 0.06
84 0.05
85 0.05
86 0.04
87 0.04
88 0.03
89 0.03
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.03