Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2GCG9

Protein Details
Accession A0A2I2GCG9    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
186-205ASPRQPPRSKSNKKATSFLDHydrophilic
NLS Segment(s)
PositionSequence
153-155KKR
211-218RSKRRKKK
Subcellular Location(s) nucl 16, mito 6.5, cyto_mito 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021641  DUF3245  
Pfam View protein in Pfam  
PF11595  DUF3245  
Amino Acid Sequences MSMSRSETDIILNKANVALARSQRLVASWLPPQTSEELANLKSEEELQREEDEIFTAVPETLGIGAPLPTKAADGSWNRTELDSNDKLRKQLLGKNYKRVVAASAGASATVTPGKPGTRANPGPSAKELDDEDGHDEDEGRTTSVGTSQRRLKKRKAALEGSHNHHEVATSAGEGQENITSPQEGASPRQPPRSKSNKKATSFLDEILADRSKRRKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.2
4 0.16
5 0.19
6 0.19
7 0.24
8 0.24
9 0.25
10 0.24
11 0.24
12 0.25
13 0.22
14 0.21
15 0.22
16 0.24
17 0.24
18 0.24
19 0.25
20 0.25
21 0.25
22 0.22
23 0.2
24 0.2
25 0.19
26 0.2
27 0.19
28 0.16
29 0.15
30 0.17
31 0.17
32 0.17
33 0.18
34 0.19
35 0.2
36 0.2
37 0.2
38 0.17
39 0.15
40 0.13
41 0.11
42 0.08
43 0.08
44 0.07
45 0.06
46 0.06
47 0.05
48 0.05
49 0.05
50 0.05
51 0.04
52 0.05
53 0.06
54 0.06
55 0.07
56 0.06
57 0.06
58 0.06
59 0.07
60 0.12
61 0.15
62 0.21
63 0.22
64 0.23
65 0.23
66 0.24
67 0.24
68 0.19
69 0.24
70 0.23
71 0.25
72 0.3
73 0.31
74 0.31
75 0.31
76 0.34
77 0.29
78 0.29
79 0.35
80 0.39
81 0.42
82 0.5
83 0.52
84 0.5
85 0.47
86 0.42
87 0.34
88 0.24
89 0.22
90 0.13
91 0.12
92 0.1
93 0.09
94 0.09
95 0.07
96 0.06
97 0.05
98 0.05
99 0.04
100 0.06
101 0.06
102 0.08
103 0.09
104 0.12
105 0.19
106 0.22
107 0.24
108 0.31
109 0.32
110 0.33
111 0.33
112 0.33
113 0.25
114 0.25
115 0.22
116 0.17
117 0.16
118 0.15
119 0.16
120 0.13
121 0.13
122 0.11
123 0.11
124 0.09
125 0.1
126 0.09
127 0.07
128 0.07
129 0.07
130 0.07
131 0.11
132 0.17
133 0.18
134 0.23
135 0.31
136 0.4
137 0.48
138 0.55
139 0.59
140 0.63
141 0.7
142 0.74
143 0.74
144 0.74
145 0.71
146 0.75
147 0.73
148 0.7
149 0.66
150 0.57
151 0.48
152 0.4
153 0.34
154 0.24
155 0.19
156 0.13
157 0.08
158 0.08
159 0.09
160 0.09
161 0.09
162 0.09
163 0.08
164 0.08
165 0.09
166 0.1
167 0.1
168 0.1
169 0.11
170 0.13
171 0.13
172 0.17
173 0.23
174 0.3
175 0.34
176 0.44
177 0.48
178 0.5
179 0.59
180 0.66
181 0.69
182 0.72
183 0.79
184 0.78
185 0.78
186 0.8
187 0.75
188 0.72
189 0.64
190 0.54
191 0.47
192 0.38
193 0.35
194 0.32
195 0.32
196 0.24
197 0.28
198 0.37