Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2G5U2

Protein Details
Accession A0A2I2G5U2    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
25-69GNDPRGRERGKRRGKRKKKGKQTPKGKEKRKRKAGRKKEAVPGIABasic
NLS Segment(s)
PositionSequence
28-63PRGRERGKRRGKRKKKGKQTPKGKEKRKRKAGRKKE
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MEVNGGERETKDGEKGEGGDRVSEGNDPRGRERGKRRGKRKKKGKQTPKGKEKRKRKAGRKKEAVPGIALATTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.21
5 0.2
6 0.18
7 0.16
8 0.16
9 0.15
10 0.15
11 0.14
12 0.18
13 0.2
14 0.22
15 0.23
16 0.3
17 0.31
18 0.36
19 0.45
20 0.48
21 0.57
22 0.64
23 0.73
24 0.78
25 0.87
26 0.9
27 0.92
28 0.91
29 0.92
30 0.94
31 0.94
32 0.93
33 0.93
34 0.93
35 0.93
36 0.93
37 0.93
38 0.92
39 0.92
40 0.92
41 0.92
42 0.92
43 0.92
44 0.93
45 0.94
46 0.95
47 0.94
48 0.9
49 0.89
50 0.85
51 0.76
52 0.67
53 0.57
54 0.47