Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2GNU8

Protein Details
Accession A0A2I2GNU8    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
86-117KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MSPLRSILGSSTGALRQFLPSLARQSWTRGLFSTRPFSQLAKISLSNGLRALRSGAQSSNVGVASVGSTVRQIEQVRGMKTRSAVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.15
4 0.15
5 0.16
6 0.16
7 0.16
8 0.21
9 0.21
10 0.24
11 0.23
12 0.27
13 0.33
14 0.32
15 0.31
16 0.27
17 0.3
18 0.31
19 0.35
20 0.37
21 0.3
22 0.31
23 0.31
24 0.31
25 0.3
26 0.3
27 0.28
28 0.24
29 0.24
30 0.22
31 0.26
32 0.25
33 0.22
34 0.19
35 0.18
36 0.14
37 0.14
38 0.15
39 0.12
40 0.13
41 0.13
42 0.11
43 0.12
44 0.13
45 0.13
46 0.12
47 0.1
48 0.09
49 0.07
50 0.07
51 0.05
52 0.05
53 0.05
54 0.04
55 0.04
56 0.04
57 0.05
58 0.09
59 0.09
60 0.1
61 0.18
62 0.22
63 0.24
64 0.27
65 0.27
66 0.25
67 0.28
68 0.35
69 0.33
70 0.36
71 0.37
72 0.38
73 0.46
74 0.49
75 0.5
76 0.47
77 0.48
78 0.5
79 0.56
80 0.62
81 0.63
82 0.69
83 0.73
84 0.76
85 0.79
86 0.81
87 0.79
88 0.78
89 0.78
90 0.76
91 0.77
92 0.79
93 0.75
94 0.75
95 0.77
96 0.81
97 0.82