Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2G9T6

Protein Details
Accession A0A2I2G9T6   
Localization Confidence High
Confidence Score 23.2
NoLS Segment(s)
PositionSequenceProtein Nature
478-497TGTPSKKRGRPRKSGVPGEEBasic
576-615DGSVVPMKRRRGRPRKSEMDPNAPPKPKAPRKPSSKPTGTHydrophilic
651-675LQLPPHQPKKPKTQQQQPQQQQPAQHydrophilic
NLS Segment(s)
PositionSequence
421-429PAAKKRPKQ
482-508SKKRGRPRKSGVPGEENTKPAKPRKPK
583-627KRRRGRPRKSEMDPNAPPKPKAPRKPSSKPTGTGRPRGRPRKADI
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MMGYGGHPFAQQRQSQQSSHPQHQQHQLQSPSMGAAHPHHGSGIANNSSLLRGQSQTTDLTAANSPDIRKLTPSSAPLVGLPPGGNFSPFPSHYQPQGSADLLQRNTETVGQLKDPYLSLQSLQRNMNPMAANFRPHPAAMGAQAGLSPHAHAMTISSPQQSLERMQQQHLQHRQSTHSHPSASTSAGASPMMAASQPQQQQPQQQYHQQQPQYQQAQSHHQYQHAQYQQAQQSPYQQAQAHASPYQQAQQSPYQQVQQTYQQQQQAHAQAQQQQQAQQQQQAQQAQQQQAQQAQQAQQSQAQQHSFQQQQHPRYQQQQAQRSPYQSQPQQPQQPAHQQHQFQQHTFQARQYQQPQTQFHQQSHQPPHSILAQQQPHRPQSSTPSTVGPIDLISADNNNDTTAATSNPNIAAPAPAGPAAPAAKKRPKQPVKPTASPAANPIQINGQVHQQPMYLPEGQPVEQQQQPAGAPGENSSATGTPSKKRGRPRKSGVPGEENTKPAKPRKPKQSAAANAANAANNAVPGLPESAVPTLPGSMPPGAPGALAGAPGGDPHAPGSATSSAPKPPPPMITNPDGSVVPMKRRRGRPRKSEMDPNAPPKPKAPRKPSSKPTGTGRPRGRPRKADIAARAAHAEAEAQAKAQGLPPPPPLQLPPHQPKKPKTQQQQPQQQQPAQPQQPQQQQQQQQTPQPQPQAQPQAPTPVQPQPQAHPPSAVSHGQVHHHNQLAHAHNQLPQSQLSQSHLQHQMPQTQMQAAAAARVQPQAQPQMHMQHPHAHHAHGHLQQPQPHQIPMPPQSQPQMQVHPQPPRHAQPPLHHPQAHAHALPHPHGVDPLGLNPGQKRGPSSVDDDPRKRAYMMPQHM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.54
4 0.58
5 0.59
6 0.64
7 0.66
8 0.62
9 0.65
10 0.73
11 0.74
12 0.72
13 0.72
14 0.68
15 0.61
16 0.56
17 0.49
18 0.4
19 0.33
20 0.25
21 0.19
22 0.18
23 0.22
24 0.22
25 0.21
26 0.2
27 0.2
28 0.2
29 0.21
30 0.25
31 0.21
32 0.2
33 0.21
34 0.21
35 0.21
36 0.22
37 0.19
38 0.15
39 0.14
40 0.16
41 0.18
42 0.2
43 0.2
44 0.2
45 0.21
46 0.18
47 0.19
48 0.2
49 0.18
50 0.19
51 0.21
52 0.2
53 0.23
54 0.26
55 0.24
56 0.25
57 0.28
58 0.3
59 0.32
60 0.34
61 0.33
62 0.33
63 0.32
64 0.3
65 0.28
66 0.24
67 0.2
68 0.17
69 0.13
70 0.15
71 0.14
72 0.14
73 0.12
74 0.15
75 0.21
76 0.22
77 0.28
78 0.32
79 0.35
80 0.38
81 0.42
82 0.41
83 0.38
84 0.4
85 0.35
86 0.32
87 0.34
88 0.36
89 0.32
90 0.31
91 0.28
92 0.25
93 0.25
94 0.23
95 0.21
96 0.17
97 0.19
98 0.19
99 0.21
100 0.21
101 0.21
102 0.2
103 0.2
104 0.18
105 0.17
106 0.17
107 0.22
108 0.27
109 0.31
110 0.33
111 0.34
112 0.36
113 0.36
114 0.4
115 0.34
116 0.29
117 0.31
118 0.3
119 0.32
120 0.28
121 0.3
122 0.27
123 0.25
124 0.26
125 0.2
126 0.2
127 0.17
128 0.17
129 0.14
130 0.13
131 0.13
132 0.12
133 0.11
134 0.1
135 0.09
136 0.07
137 0.07
138 0.07
139 0.07
140 0.09
141 0.09
142 0.13
143 0.15
144 0.15
145 0.15
146 0.16
147 0.18
148 0.18
149 0.19
150 0.24
151 0.3
152 0.32
153 0.34
154 0.4
155 0.45
156 0.53
157 0.58
158 0.55
159 0.5
160 0.5
161 0.53
162 0.52
163 0.53
164 0.52
165 0.48
166 0.44
167 0.41
168 0.42
169 0.39
170 0.34
171 0.28
172 0.2
173 0.17
174 0.16
175 0.15
176 0.11
177 0.09
178 0.08
179 0.07
180 0.06
181 0.06
182 0.07
183 0.14
184 0.17
185 0.2
186 0.25
187 0.28
188 0.36
189 0.42
190 0.48
191 0.46
192 0.51
193 0.54
194 0.58
195 0.64
196 0.6
197 0.58
198 0.56
199 0.61
200 0.58
201 0.54
202 0.49
203 0.45
204 0.49
205 0.48
206 0.51
207 0.43
208 0.42
209 0.44
210 0.42
211 0.48
212 0.43
213 0.42
214 0.36
215 0.43
216 0.44
217 0.43
218 0.42
219 0.34
220 0.36
221 0.38
222 0.36
223 0.33
224 0.29
225 0.27
226 0.3
227 0.31
228 0.27
229 0.24
230 0.23
231 0.2
232 0.2
233 0.23
234 0.21
235 0.2
236 0.21
237 0.26
238 0.3
239 0.32
240 0.33
241 0.33
242 0.33
243 0.34
244 0.33
245 0.35
246 0.38
247 0.4
248 0.42
249 0.43
250 0.42
251 0.42
252 0.45
253 0.42
254 0.36
255 0.34
256 0.32
257 0.34
258 0.37
259 0.4
260 0.35
261 0.35
262 0.37
263 0.4
264 0.39
265 0.37
266 0.36
267 0.37
268 0.41
269 0.4
270 0.37
271 0.35
272 0.39
273 0.37
274 0.37
275 0.34
276 0.3
277 0.3
278 0.31
279 0.28
280 0.25
281 0.25
282 0.25
283 0.25
284 0.24
285 0.24
286 0.26
287 0.26
288 0.27
289 0.26
290 0.23
291 0.24
292 0.3
293 0.31
294 0.31
295 0.38
296 0.41
297 0.45
298 0.51
299 0.54
300 0.52
301 0.55
302 0.58
303 0.54
304 0.56
305 0.6
306 0.58
307 0.59
308 0.58
309 0.55
310 0.51
311 0.51
312 0.49
313 0.45
314 0.46
315 0.47
316 0.52
317 0.56
318 0.57
319 0.54
320 0.51
321 0.56
322 0.54
323 0.52
324 0.5
325 0.44
326 0.46
327 0.54
328 0.52
329 0.42
330 0.42
331 0.4
332 0.39
333 0.38
334 0.35
335 0.33
336 0.33
337 0.38
338 0.4
339 0.43
340 0.42
341 0.49
342 0.49
343 0.46
344 0.53
345 0.49
346 0.45
347 0.43
348 0.43
349 0.45
350 0.49
351 0.48
352 0.39
353 0.36
354 0.37
355 0.34
356 0.31
357 0.25
358 0.25
359 0.28
360 0.3
361 0.35
362 0.38
363 0.39
364 0.4
365 0.38
366 0.31
367 0.33
368 0.37
369 0.35
370 0.31
371 0.29
372 0.28
373 0.27
374 0.26
375 0.18
376 0.11
377 0.08
378 0.07
379 0.06
380 0.05
381 0.05
382 0.06
383 0.06
384 0.06
385 0.06
386 0.05
387 0.05
388 0.06
389 0.06
390 0.07
391 0.08
392 0.08
393 0.09
394 0.09
395 0.09
396 0.08
397 0.07
398 0.07
399 0.06
400 0.06
401 0.06
402 0.06
403 0.06
404 0.05
405 0.06
406 0.07
407 0.09
408 0.11
409 0.16
410 0.24
411 0.28
412 0.34
413 0.44
414 0.52
415 0.6
416 0.68
417 0.73
418 0.73
419 0.74
420 0.71
421 0.66
422 0.59
423 0.5
424 0.42
425 0.35
426 0.3
427 0.25
428 0.22
429 0.17
430 0.17
431 0.18
432 0.15
433 0.15
434 0.14
435 0.15
436 0.15
437 0.13
438 0.12
439 0.13
440 0.15
441 0.12
442 0.1
443 0.13
444 0.14
445 0.14
446 0.15
447 0.15
448 0.16
449 0.16
450 0.16
451 0.14
452 0.14
453 0.13
454 0.13
455 0.13
456 0.09
457 0.08
458 0.09
459 0.1
460 0.09
461 0.09
462 0.08
463 0.08
464 0.09
465 0.12
466 0.14
467 0.14
468 0.23
469 0.29
470 0.33
471 0.43
472 0.53
473 0.59
474 0.67
475 0.73
476 0.75
477 0.78
478 0.8
479 0.75
480 0.71
481 0.63
482 0.58
483 0.52
484 0.43
485 0.37
486 0.32
487 0.31
488 0.31
489 0.38
490 0.44
491 0.5
492 0.59
493 0.66
494 0.69
495 0.73
496 0.76
497 0.72
498 0.69
499 0.65
500 0.54
501 0.46
502 0.42
503 0.34
504 0.24
505 0.19
506 0.11
507 0.07
508 0.06
509 0.05
510 0.04
511 0.04
512 0.06
513 0.05
514 0.06
515 0.07
516 0.08
517 0.08
518 0.08
519 0.08
520 0.07
521 0.07
522 0.08
523 0.08
524 0.09
525 0.09
526 0.09
527 0.09
528 0.09
529 0.08
530 0.08
531 0.07
532 0.06
533 0.06
534 0.05
535 0.04
536 0.04
537 0.04
538 0.05
539 0.04
540 0.04
541 0.05
542 0.06
543 0.06
544 0.06
545 0.1
546 0.11
547 0.11
548 0.13
549 0.14
550 0.16
551 0.18
552 0.21
553 0.2
554 0.21
555 0.26
556 0.27
557 0.32
558 0.33
559 0.35
560 0.35
561 0.32
562 0.31
563 0.26
564 0.23
565 0.23
566 0.2
567 0.25
568 0.29
569 0.36
570 0.43
571 0.53
572 0.64
573 0.69
574 0.77
575 0.79
576 0.83
577 0.85
578 0.83
579 0.84
580 0.79
581 0.78
582 0.74
583 0.71
584 0.69
585 0.63
586 0.57
587 0.52
588 0.56
589 0.56
590 0.6
591 0.62
592 0.63
593 0.7
594 0.8
595 0.83
596 0.83
597 0.79
598 0.74
599 0.72
600 0.73
601 0.7
602 0.7
603 0.69
604 0.69
605 0.73
606 0.78
607 0.79
608 0.75
609 0.75
610 0.76
611 0.73
612 0.71
613 0.65
614 0.62
615 0.55
616 0.49
617 0.44
618 0.33
619 0.28
620 0.2
621 0.16
622 0.09
623 0.1
624 0.09
625 0.08
626 0.09
627 0.09
628 0.1
629 0.12
630 0.16
631 0.16
632 0.19
633 0.23
634 0.26
635 0.26
636 0.27
637 0.27
638 0.28
639 0.32
640 0.39
641 0.45
642 0.52
643 0.58
644 0.64
645 0.68
646 0.74
647 0.78
648 0.78
649 0.79
650 0.79
651 0.83
652 0.85
653 0.9
654 0.87
655 0.87
656 0.84
657 0.78
658 0.72
659 0.71
660 0.71
661 0.66
662 0.63
663 0.59
664 0.61
665 0.66
666 0.67
667 0.66
668 0.65
669 0.67
670 0.7
671 0.72
672 0.69
673 0.67
674 0.69
675 0.67
676 0.64
677 0.63
678 0.59
679 0.54
680 0.57
681 0.6
682 0.53
683 0.5
684 0.46
685 0.48
686 0.44
687 0.43
688 0.39
689 0.36
690 0.38
691 0.4
692 0.41
693 0.37
694 0.46
695 0.47
696 0.44
697 0.39
698 0.36
699 0.34
700 0.36
701 0.34
702 0.26
703 0.27
704 0.28
705 0.29
706 0.34
707 0.35
708 0.35
709 0.38
710 0.36
711 0.33
712 0.39
713 0.4
714 0.37
715 0.35
716 0.32
717 0.32
718 0.34
719 0.34
720 0.28
721 0.25
722 0.24
723 0.23
724 0.24
725 0.25
726 0.29
727 0.28
728 0.34
729 0.4
730 0.38
731 0.43
732 0.44
733 0.46
734 0.42
735 0.43
736 0.37
737 0.32
738 0.32
739 0.25
740 0.24
741 0.17
742 0.16
743 0.14
744 0.14
745 0.14
746 0.16
747 0.16
748 0.16
749 0.21
750 0.28
751 0.29
752 0.29
753 0.32
754 0.38
755 0.41
756 0.44
757 0.41
758 0.41
759 0.42
760 0.47
761 0.45
762 0.39
763 0.37
764 0.38
765 0.43
766 0.4
767 0.43
768 0.42
769 0.45
770 0.49
771 0.52
772 0.56
773 0.51
774 0.47
775 0.44
776 0.41
777 0.44
778 0.44
779 0.45
780 0.39
781 0.4
782 0.43
783 0.45
784 0.47
785 0.44
786 0.46
787 0.45
788 0.52
789 0.56
790 0.61
791 0.61
792 0.62
793 0.64
794 0.64
795 0.65
796 0.63
797 0.62
798 0.61
799 0.67
800 0.68
801 0.7
802 0.64
803 0.6
804 0.6
805 0.61
806 0.58
807 0.5
808 0.43
809 0.39
810 0.42
811 0.43
812 0.39
813 0.32
814 0.27
815 0.26
816 0.25
817 0.23
818 0.2
819 0.2
820 0.2
821 0.2
822 0.22
823 0.22
824 0.27
825 0.28
826 0.28
827 0.3
828 0.3
829 0.34
830 0.35
831 0.4
832 0.43
833 0.5
834 0.58
835 0.59
836 0.61
837 0.61
838 0.6
839 0.55
840 0.5
841 0.5