Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2GLN6

Protein Details
Accession A0A2I2GLN6   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
123-143SLFGPRSKSRSQSPRKRQRPVHydrophilic
NLS Segment(s)
PositionSequence
132-141RSQSPRKRQR
Subcellular Location(s) nucl 17, cyto_nucl 11, cyto 3, mito 2, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003615  HNH_nuc  
Pfam View protein in Pfam  
PF13391  HNH_2  
Amino Acid Sequences MYMHTLSEEHSTDTNCPENAILLRKDIHYLWDTHKFAIVPKQNKWVIHVLNSQATIELQDKYHNLETQPITGVPPQFLLARFALAILTEKIIFVKQGFPRKLNIKLADGTVQPKVLSSEECCSLFGPRSKSRSQSPRKRQRPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.22
4 0.19
5 0.2
6 0.21
7 0.25
8 0.22
9 0.21
10 0.22
11 0.22
12 0.24
13 0.22
14 0.23
15 0.19
16 0.21
17 0.24
18 0.32
19 0.33
20 0.3
21 0.32
22 0.28
23 0.29
24 0.35
25 0.38
26 0.34
27 0.35
28 0.44
29 0.45
30 0.45
31 0.47
32 0.44
33 0.37
34 0.36
35 0.37
36 0.31
37 0.29
38 0.29
39 0.25
40 0.18
41 0.17
42 0.14
43 0.12
44 0.1
45 0.08
46 0.1
47 0.1
48 0.14
49 0.16
50 0.15
51 0.14
52 0.19
53 0.19
54 0.18
55 0.18
56 0.15
57 0.14
58 0.14
59 0.15
60 0.09
61 0.09
62 0.09
63 0.09
64 0.1
65 0.11
66 0.09
67 0.09
68 0.09
69 0.09
70 0.08
71 0.07
72 0.08
73 0.05
74 0.06
75 0.06
76 0.06
77 0.06
78 0.07
79 0.07
80 0.07
81 0.13
82 0.18
83 0.27
84 0.3
85 0.31
86 0.37
87 0.41
88 0.47
89 0.48
90 0.46
91 0.4
92 0.38
93 0.39
94 0.36
95 0.33
96 0.29
97 0.23
98 0.21
99 0.17
100 0.16
101 0.16
102 0.15
103 0.15
104 0.16
105 0.18
106 0.21
107 0.22
108 0.22
109 0.21
110 0.22
111 0.26
112 0.28
113 0.32
114 0.36
115 0.41
116 0.46
117 0.5
118 0.58
119 0.63
120 0.68
121 0.72
122 0.76
123 0.82