Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FZR8

Protein Details
Accession A0A2I2FZR8   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-60ENANGLRRPREPKKVKRRKKRRKIIMRMEKAQKEKRKIRKERPLRDDQIGBasic
NLS Segment(s)
PositionSequence
17-53RRPREPKKVKRRKKRRKIIMRMEKAQKEKRKIRKERP
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MRSGDYGWSHENANGLRRPREPKKVKRRKKRRKIIMRMEKAQKEKRKIRKERPLRDDQIGVDLSPAGTTQGYLQRER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.33
4 0.37
5 0.45
6 0.49
7 0.58
8 0.63
9 0.68
10 0.76
11 0.83
12 0.88
13 0.9
14 0.94
15 0.94
16 0.95
17 0.95
18 0.95
19 0.95
20 0.95
21 0.95
22 0.94
23 0.9
24 0.87
25 0.83
26 0.77
27 0.73
28 0.71
29 0.67
30 0.65
31 0.67
32 0.7
33 0.74
34 0.79
35 0.82
36 0.85
37 0.88
38 0.9
39 0.89
40 0.88
41 0.82
42 0.76
43 0.68
44 0.57
45 0.51
46 0.41
47 0.33
48 0.23
49 0.18
50 0.14
51 0.11
52 0.1
53 0.07
54 0.06
55 0.06
56 0.1
57 0.17