Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2G5C3

Protein Details
Accession A0A2I2G5C3    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
514-533ADAAAKRKSKKTAAAKNAEEHydrophilic
NLS Segment(s)
PositionSequence
519-524KRKSKK
Subcellular Location(s) mito 10, cyto 6, plas 6, pero 2, nucl 1, extr 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR026749  Tmem135  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASDSTGNVDIQPHVHPVVRNALRISLSAKEYKTLHHLVAQRAPSFQSRLPSPSKYEAIVRSQNRHNEAAFRTSARVFLVSGALLKLVDLVARRIRGEASRKDRRISLFRSPNFRLSLSLSLMLLLHRLLHRFFVRLRANLRTEEAEPFRKRNPRVSKALTSRYAPAVGASLAGFALGICPQKQLRMTAAIYTGTRSLEFIFNVFDEKGWVENRPWWFGSWLLMPISCAQLFHAFVFDRETTPGWLGKVIMRLSPAYIHGRPETLPAEFPWPEKEAIVDSLATVAKLRWPAFISPILHPGDPYTLPSTIKSISPITGPAHPSISSLSCALLHPGCPSCGTTFLHHLLLSVPPLARFITMVTLALSALKFKSFLTQPITSINNLSKRIIALTGILSASVGSAWGSICLWNAILPRSVLPTQRFFLSGAAAGVPFAFLSSSRNIFLYFFRAAVDSAWKSGVKRGLWKGWKGGDLFVVVITWALMGSILETRPSAVQGKGVRKALAWMRGDGYVDPADAAAKRKSKKTAAAKNAEEET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.23
4 0.24
5 0.34
6 0.35
7 0.36
8 0.34
9 0.36
10 0.34
11 0.34
12 0.33
13 0.28
14 0.29
15 0.31
16 0.3
17 0.31
18 0.31
19 0.33
20 0.38
21 0.36
22 0.33
23 0.34
24 0.4
25 0.41
26 0.47
27 0.49
28 0.43
29 0.41
30 0.42
31 0.4
32 0.39
33 0.35
34 0.34
35 0.32
36 0.37
37 0.41
38 0.43
39 0.45
40 0.47
41 0.46
42 0.42
43 0.44
44 0.43
45 0.45
46 0.5
47 0.5
48 0.5
49 0.55
50 0.61
51 0.59
52 0.58
53 0.51
54 0.49
55 0.47
56 0.45
57 0.41
58 0.35
59 0.33
60 0.3
61 0.31
62 0.25
63 0.22
64 0.17
65 0.16
66 0.15
67 0.12
68 0.12
69 0.11
70 0.1
71 0.09
72 0.08
73 0.07
74 0.06
75 0.07
76 0.07
77 0.12
78 0.16
79 0.18
80 0.19
81 0.19
82 0.21
83 0.27
84 0.34
85 0.39
86 0.45
87 0.54
88 0.57
89 0.59
90 0.62
91 0.62
92 0.62
93 0.59
94 0.6
95 0.59
96 0.61
97 0.66
98 0.65
99 0.64
100 0.58
101 0.52
102 0.43
103 0.37
104 0.36
105 0.3
106 0.27
107 0.22
108 0.19
109 0.19
110 0.16
111 0.13
112 0.09
113 0.09
114 0.09
115 0.11
116 0.11
117 0.16
118 0.17
119 0.2
120 0.21
121 0.28
122 0.31
123 0.34
124 0.38
125 0.4
126 0.41
127 0.4
128 0.42
129 0.35
130 0.32
131 0.33
132 0.34
133 0.36
134 0.36
135 0.38
136 0.43
137 0.48
138 0.5
139 0.54
140 0.6
141 0.58
142 0.64
143 0.68
144 0.7
145 0.69
146 0.74
147 0.67
148 0.58
149 0.53
150 0.46
151 0.4
152 0.3
153 0.23
154 0.16
155 0.13
156 0.11
157 0.08
158 0.07
159 0.05
160 0.05
161 0.05
162 0.03
163 0.04
164 0.05
165 0.06
166 0.07
167 0.09
168 0.1
169 0.13
170 0.14
171 0.16
172 0.16
173 0.2
174 0.2
175 0.2
176 0.21
177 0.19
178 0.18
179 0.17
180 0.16
181 0.12
182 0.11
183 0.1
184 0.1
185 0.11
186 0.1
187 0.1
188 0.1
189 0.09
190 0.11
191 0.1
192 0.09
193 0.08
194 0.08
195 0.1
196 0.1
197 0.12
198 0.11
199 0.16
200 0.18
201 0.21
202 0.21
203 0.19
204 0.19
205 0.18
206 0.19
207 0.15
208 0.14
209 0.12
210 0.11
211 0.11
212 0.1
213 0.12
214 0.1
215 0.09
216 0.08
217 0.1
218 0.11
219 0.1
220 0.12
221 0.1
222 0.1
223 0.13
224 0.13
225 0.11
226 0.12
227 0.13
228 0.11
229 0.13
230 0.13
231 0.1
232 0.1
233 0.1
234 0.1
235 0.14
236 0.14
237 0.13
238 0.13
239 0.13
240 0.13
241 0.13
242 0.14
243 0.14
244 0.15
245 0.16
246 0.15
247 0.16
248 0.16
249 0.18
250 0.17
251 0.12
252 0.12
253 0.11
254 0.15
255 0.14
256 0.15
257 0.14
258 0.15
259 0.15
260 0.14
261 0.14
262 0.11
263 0.11
264 0.11
265 0.09
266 0.07
267 0.08
268 0.08
269 0.07
270 0.07
271 0.06
272 0.07
273 0.11
274 0.11
275 0.11
276 0.13
277 0.14
278 0.16
279 0.2
280 0.2
281 0.18
282 0.23
283 0.23
284 0.21
285 0.2
286 0.18
287 0.17
288 0.14
289 0.15
290 0.12
291 0.12
292 0.13
293 0.13
294 0.14
295 0.13
296 0.13
297 0.14
298 0.13
299 0.12
300 0.12
301 0.14
302 0.14
303 0.17
304 0.18
305 0.17
306 0.17
307 0.16
308 0.17
309 0.16
310 0.15
311 0.12
312 0.11
313 0.1
314 0.1
315 0.1
316 0.11
317 0.1
318 0.1
319 0.11
320 0.11
321 0.11
322 0.11
323 0.13
324 0.11
325 0.14
326 0.15
327 0.15
328 0.18
329 0.2
330 0.21
331 0.19
332 0.19
333 0.16
334 0.15
335 0.14
336 0.12
337 0.1
338 0.09
339 0.1
340 0.1
341 0.09
342 0.08
343 0.08
344 0.08
345 0.08
346 0.08
347 0.08
348 0.08
349 0.08
350 0.09
351 0.08
352 0.07
353 0.07
354 0.07
355 0.07
356 0.07
357 0.13
358 0.13
359 0.18
360 0.23
361 0.24
362 0.24
363 0.29
364 0.3
365 0.25
366 0.27
367 0.27
368 0.27
369 0.27
370 0.27
371 0.23
372 0.22
373 0.22
374 0.2
375 0.16
376 0.11
377 0.1
378 0.11
379 0.1
380 0.09
381 0.08
382 0.07
383 0.07
384 0.05
385 0.04
386 0.03
387 0.04
388 0.04
389 0.04
390 0.05
391 0.05
392 0.06
393 0.06
394 0.06
395 0.08
396 0.1
397 0.11
398 0.12
399 0.12
400 0.12
401 0.17
402 0.19
403 0.23
404 0.25
405 0.28
406 0.29
407 0.29
408 0.3
409 0.26
410 0.24
411 0.2
412 0.17
413 0.13
414 0.12
415 0.1
416 0.09
417 0.08
418 0.07
419 0.05
420 0.05
421 0.04
422 0.04
423 0.07
424 0.11
425 0.13
426 0.14
427 0.15
428 0.15
429 0.16
430 0.18
431 0.2
432 0.17
433 0.15
434 0.15
435 0.16
436 0.15
437 0.15
438 0.2
439 0.16
440 0.17
441 0.19
442 0.2
443 0.2
444 0.25
445 0.3
446 0.26
447 0.34
448 0.39
449 0.47
450 0.53
451 0.56
452 0.57
453 0.55
454 0.57
455 0.5
456 0.44
457 0.37
458 0.3
459 0.27
460 0.2
461 0.15
462 0.11
463 0.09
464 0.07
465 0.05
466 0.04
467 0.03
468 0.03
469 0.03
470 0.05
471 0.07
472 0.08
473 0.09
474 0.09
475 0.11
476 0.11
477 0.14
478 0.16
479 0.14
480 0.21
481 0.27
482 0.35
483 0.41
484 0.44
485 0.42
486 0.39
487 0.45
488 0.45
489 0.46
490 0.41
491 0.36
492 0.35
493 0.36
494 0.37
495 0.3
496 0.28
497 0.21
498 0.18
499 0.16
500 0.14
501 0.14
502 0.15
503 0.19
504 0.22
505 0.29
506 0.34
507 0.41
508 0.49
509 0.54
510 0.62
511 0.69
512 0.73
513 0.76
514 0.8
515 0.78