Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2FTX3

Protein Details
Accession A0A2I2FTX3    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
48-69LRAVPKKKTSHMKKRHRQMAGKBasic
NLS Segment(s)
PositionSequence
52-68PKKKTSHMKKRHRQMAG
Subcellular Location(s) mito 19, nucl 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MASPTMSIAAGRWSRVLLESAPVHNLWRPAAFALNVPGLLSGVWDSVLRAVPKKKTSHMKKRHRQMAGKALKDVKNLSTCPGCGQIKRAHVLCPHCVENIKKQWKNTQTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.2
4 0.12
5 0.16
6 0.18
7 0.19
8 0.2
9 0.2
10 0.2
11 0.2
12 0.21
13 0.17
14 0.15
15 0.14
16 0.13
17 0.15
18 0.14
19 0.13
20 0.13
21 0.13
22 0.12
23 0.11
24 0.1
25 0.08
26 0.07
27 0.07
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.06
34 0.08
35 0.08
36 0.12
37 0.15
38 0.2
39 0.25
40 0.27
41 0.32
42 0.41
43 0.5
44 0.58
45 0.65
46 0.72
47 0.76
48 0.84
49 0.86
50 0.83
51 0.79
52 0.75
53 0.75
54 0.73
55 0.65
56 0.59
57 0.56
58 0.51
59 0.47
60 0.41
61 0.35
62 0.31
63 0.29
64 0.29
65 0.25
66 0.23
67 0.23
68 0.29
69 0.27
70 0.24
71 0.28
72 0.31
73 0.34
74 0.38
75 0.38
76 0.35
77 0.38
78 0.42
79 0.43
80 0.42
81 0.39
82 0.36
83 0.4
84 0.4
85 0.44
86 0.5
87 0.55
88 0.54
89 0.58
90 0.66