Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2GSD1

Protein Details
Accession A0A2I2GSD1   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
157-178CEYAARRRGSPRRCRACSCGGCHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, extr 5, nucl 4, mito 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008928  6-hairpin_glycosidase_sf  
IPR012341  6hp_glycosidase-like_sf  
Gene Ontology GO:0005975  P:carbohydrate metabolic process  
Amino Acid Sequences MDARLQILFTYQLSRDDRLARKCIQEFYASRRADGLLETHFPSSTSVVNIPFFSLYWILMVLDQLMYRGDERLVRKYLGAIDGILDHFDQRVAANRLVGRLERDVWPFVDSTREWSELSPGGGFRGLAVPPAYHRTGQMTCSSLIYSYALQKAAQVCEYAARRRGSPRRCRACSCGGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.36
4 0.42
5 0.45
6 0.49
7 0.47
8 0.51
9 0.52
10 0.52
11 0.46
12 0.46
13 0.43
14 0.45
15 0.51
16 0.43
17 0.4
18 0.37
19 0.35
20 0.28
21 0.26
22 0.2
23 0.14
24 0.16
25 0.17
26 0.17
27 0.16
28 0.16
29 0.16
30 0.15
31 0.13
32 0.12
33 0.13
34 0.14
35 0.15
36 0.15
37 0.14
38 0.13
39 0.12
40 0.12
41 0.1
42 0.08
43 0.07
44 0.07
45 0.07
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.06
56 0.07
57 0.11
58 0.13
59 0.18
60 0.2
61 0.2
62 0.19
63 0.2
64 0.2
65 0.17
66 0.15
67 0.1
68 0.08
69 0.08
70 0.08
71 0.07
72 0.06
73 0.05
74 0.05
75 0.05
76 0.04
77 0.04
78 0.1
79 0.12
80 0.13
81 0.15
82 0.15
83 0.16
84 0.17
85 0.17
86 0.13
87 0.12
88 0.14
89 0.14
90 0.16
91 0.16
92 0.16
93 0.16
94 0.14
95 0.13
96 0.15
97 0.12
98 0.16
99 0.18
100 0.19
101 0.18
102 0.18
103 0.21
104 0.18
105 0.19
106 0.14
107 0.11
108 0.1
109 0.1
110 0.1
111 0.08
112 0.09
113 0.08
114 0.09
115 0.1
116 0.09
117 0.11
118 0.16
119 0.17
120 0.15
121 0.16
122 0.2
123 0.21
124 0.23
125 0.24
126 0.22
127 0.21
128 0.22
129 0.21
130 0.16
131 0.15
132 0.15
133 0.13
134 0.14
135 0.16
136 0.16
137 0.16
138 0.18
139 0.21
140 0.22
141 0.21
142 0.18
143 0.16
144 0.22
145 0.27
146 0.3
147 0.33
148 0.33
149 0.35
150 0.45
151 0.54
152 0.58
153 0.64
154 0.69
155 0.74
156 0.79
157 0.82
158 0.79