Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2G8L8

Protein Details
Accession A0A2I2G8L8   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
152-186RERDWEREKGKRNTTCKRNPHTQRARPLQSRERKTBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MTCHLLARVLKLQDEPSQFKPQLNQTGTASLFIFRRNQATKSKPLSGPRPWNRTRNRVDTRRDTNECRRMSQNLVKLQDESSTQNESSRKDAAPSVNSVQRSFYASKKEKVKGKHVMHGGQLWTFEVVMSKMTIRICRVELPCSPSLRVRERERDWEREKGKRNTTCKRNPHTQRARPLQSRERKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.39
4 0.46
5 0.46
6 0.45
7 0.48
8 0.49
9 0.52
10 0.49
11 0.46
12 0.39
13 0.43
14 0.41
15 0.37
16 0.3
17 0.22
18 0.21
19 0.2
20 0.21
21 0.18
22 0.25
23 0.26
24 0.3
25 0.37
26 0.42
27 0.49
28 0.51
29 0.57
30 0.54
31 0.58
32 0.62
33 0.62
34 0.67
35 0.67
36 0.7
37 0.69
38 0.73
39 0.74
40 0.76
41 0.74
42 0.74
43 0.74
44 0.73
45 0.76
46 0.76
47 0.77
48 0.75
49 0.73
50 0.7
51 0.7
52 0.7
53 0.64
54 0.58
55 0.53
56 0.47
57 0.49
58 0.48
59 0.44
60 0.42
61 0.43
62 0.4
63 0.38
64 0.35
65 0.3
66 0.25
67 0.21
68 0.17
69 0.17
70 0.16
71 0.19
72 0.2
73 0.2
74 0.21
75 0.21
76 0.19
77 0.17
78 0.2
79 0.19
80 0.18
81 0.2
82 0.2
83 0.2
84 0.21
85 0.2
86 0.18
87 0.17
88 0.19
89 0.18
90 0.18
91 0.25
92 0.28
93 0.34
94 0.4
95 0.45
96 0.47
97 0.5
98 0.56
99 0.57
100 0.57
101 0.57
102 0.55
103 0.52
104 0.48
105 0.46
106 0.38
107 0.28
108 0.25
109 0.18
110 0.14
111 0.11
112 0.09
113 0.07
114 0.06
115 0.06
116 0.06
117 0.06
118 0.09
119 0.11
120 0.13
121 0.14
122 0.17
123 0.18
124 0.24
125 0.26
126 0.27
127 0.29
128 0.33
129 0.35
130 0.35
131 0.35
132 0.34
133 0.38
134 0.42
135 0.46
136 0.48
137 0.53
138 0.56
139 0.65
140 0.66
141 0.69
142 0.66
143 0.68
144 0.67
145 0.67
146 0.72
147 0.71
148 0.75
149 0.74
150 0.79
151 0.79
152 0.84
153 0.85
154 0.85
155 0.84
156 0.85
157 0.86
158 0.87
159 0.88
160 0.86
161 0.87
162 0.87
163 0.89
164 0.86
165 0.86
166 0.85