Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2GJM1

Protein Details
Accession A0A2I2GJM1    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-35SRARHACEPCRRKKTKCPGEKPACSFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MDDRASPNESRARHACEPCRRKKTKCPGEKPACSFCRRLNQRCTYSRDEGSRDFKVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.56
3 0.61
4 0.69
5 0.73
6 0.79
7 0.77
8 0.76
9 0.8
10 0.82
11 0.81
12 0.82
13 0.8
14 0.81
15 0.83
16 0.83
17 0.77
18 0.75
19 0.69
20 0.61
21 0.56
22 0.49
23 0.51
24 0.54
25 0.56
26 0.57
27 0.62
28 0.67
29 0.71
30 0.73
31 0.69
32 0.67
33 0.65
34 0.61
35 0.57
36 0.56
37 0.56