Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2FVC9

Protein Details
Accession A0A2I2FVC9    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
32-52KTSSMMSGPKRPKKRRGSTAVHydrophilic
NLS Segment(s)
PositionSequence
40-47PKRPKKRR
Subcellular Location(s) mito 14, nucl 7, extr 3, plas 2
Family & Domain DBs
Amino Acid Sequences MVWTCTIPSSPLPCLTFSLPPISCTNPHWQQKTSSMMSGPKRPKKRRGSTAVIGSWRQSMDAWNGGKCSRRLSARADQGVLEWERRALCYGIGLDGPGREDSGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.29
4 0.26
5 0.31
6 0.25
7 0.27
8 0.28
9 0.28
10 0.27
11 0.27
12 0.35
13 0.36
14 0.43
15 0.44
16 0.44
17 0.44
18 0.48
19 0.51
20 0.44
21 0.36
22 0.31
23 0.34
24 0.36
25 0.41
26 0.45
27 0.47
28 0.56
29 0.62
30 0.7
31 0.74
32 0.8
33 0.81
34 0.8
35 0.79
36 0.73
37 0.72
38 0.65
39 0.56
40 0.47
41 0.38
42 0.31
43 0.23
44 0.18
45 0.12
46 0.1
47 0.1
48 0.15
49 0.16
50 0.15
51 0.17
52 0.18
53 0.22
54 0.21
55 0.22
56 0.22
57 0.24
58 0.26
59 0.32
60 0.4
61 0.44
62 0.46
63 0.43
64 0.38
65 0.35
66 0.37
67 0.32
68 0.24
69 0.16
70 0.16
71 0.15
72 0.16
73 0.18
74 0.14
75 0.13
76 0.14
77 0.14
78 0.14
79 0.14
80 0.13
81 0.12
82 0.12
83 0.14
84 0.11