Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2FYD5

Protein Details
Accession A0A2I2FYD5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
121-144WDWGWGWKRKKTREGERERKTSAMHydrophilic
NLS Segment(s)
PositionSequence
128-140KRKKTREGERERK
Subcellular Location(s) extr 11, mito 8, plas 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MCLYTSTYCTACPSPRAYSFSVYQFCTALLHELQRINEDPAVAAASQAELQFCPPLCVPDLCRNVVGGVVLVRGCERCVWQGVSLVGGSGSGVLVVLVVRGVVVRGWWWWWVWRSGGSWDWDWGWGWKRKKTREGERERKTSAMRIVTSRGMRSPVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.42
4 0.4
5 0.4
6 0.4
7 0.43
8 0.42
9 0.37
10 0.33
11 0.29
12 0.26
13 0.23
14 0.2
15 0.16
16 0.14
17 0.14
18 0.16
19 0.18
20 0.19
21 0.21
22 0.22
23 0.21
24 0.2
25 0.18
26 0.15
27 0.13
28 0.14
29 0.1
30 0.09
31 0.06
32 0.06
33 0.07
34 0.07
35 0.07
36 0.06
37 0.07
38 0.09
39 0.09
40 0.11
41 0.1
42 0.11
43 0.12
44 0.14
45 0.17
46 0.24
47 0.27
48 0.26
49 0.26
50 0.24
51 0.23
52 0.22
53 0.18
54 0.09
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.07
64 0.07
65 0.09
66 0.1
67 0.1
68 0.12
69 0.12
70 0.11
71 0.1
72 0.09
73 0.07
74 0.06
75 0.05
76 0.03
77 0.03
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.02
89 0.02
90 0.03
91 0.03
92 0.04
93 0.06
94 0.07
95 0.07
96 0.11
97 0.13
98 0.15
99 0.16
100 0.18
101 0.18
102 0.21
103 0.24
104 0.23
105 0.22
106 0.22
107 0.21
108 0.2
109 0.19
110 0.2
111 0.24
112 0.29
113 0.34
114 0.4
115 0.49
116 0.57
117 0.65
118 0.71
119 0.75
120 0.78
121 0.84
122 0.87
123 0.87
124 0.86
125 0.8
126 0.75
127 0.67
128 0.62
129 0.58
130 0.54
131 0.47
132 0.43
133 0.45
134 0.47
135 0.47
136 0.44
137 0.39