Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2FQG8

Protein Details
Accession A0A2I2FQG8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
71-90LARGEAPPRRPRGRRARRSNBasic
NLS Segment(s)
PositionSequence
75-90EAPPRRPRGRRARRSN
Subcellular Location(s) nucl 12, cyto_nucl 11.333, cyto 8.5, cyto_mito 6.666, mito 3.5
Family & Domain DBs
Amino Acid Sequences IPPGIPGGAMCVQRLDDSLNSAIHINYRISLRSSSMPEPRDPLLKVLTDCDTIDSDDKTSDSVHVGVSGALARGEAPPRRPRGRRARRSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.12
4 0.14
5 0.16
6 0.15
7 0.15
8 0.16
9 0.15
10 0.14
11 0.15
12 0.12
13 0.11
14 0.12
15 0.13
16 0.14
17 0.15
18 0.16
19 0.17
20 0.21
21 0.23
22 0.28
23 0.29
24 0.28
25 0.3
26 0.29
27 0.29
28 0.25
29 0.22
30 0.18
31 0.18
32 0.17
33 0.16
34 0.16
35 0.14
36 0.13
37 0.13
38 0.12
39 0.12
40 0.13
41 0.11
42 0.1
43 0.1
44 0.1
45 0.09
46 0.09
47 0.09
48 0.09
49 0.09
50 0.08
51 0.08
52 0.08
53 0.07
54 0.08
55 0.07
56 0.06
57 0.05
58 0.05
59 0.05
60 0.08
61 0.13
62 0.17
63 0.23
64 0.31
65 0.4
66 0.5
67 0.55
68 0.63
69 0.69
70 0.77