Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MKL1

Protein Details
Accession B8MKL1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
33-60LEQQKQGKGTPRRKTKRVHKTSTTDDKKBasic
NLS Segment(s)
PositionSequence
40-49KGTPRRKTKR
Subcellular Location(s) nucl 20, cyto_nucl 12.333, mito_nucl 12.333, mito 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039370  BTF3  
IPR038187  NAC_A/B_dom_sf  
IPR002715  Nas_poly-pep-assoc_cplx_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF01849  NAC  
PROSITE View protein in PROSITE  
PS51151  NAC_AB  
CDD cd22055  NAC_BTF3  
Amino Acid Sequences MDAAKLAKLQQSVRIGYVHLPRNTSTFAHRNYLEQQKQGKGTPRRKTKRVHKTSTTDDKKLQTTLKKMNVQPIQAIEEVNMFKEDGNVIHFSNPKVHAAVPSNTFAIYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQSLQKKEAGEGKEDDDEDDIPDLVEGENFEGTVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.31
4 0.37
5 0.38
6 0.35
7 0.35
8 0.34
9 0.37
10 0.38
11 0.34
12 0.33
13 0.33
14 0.34
15 0.37
16 0.37
17 0.37
18 0.42
19 0.51
20 0.47
21 0.46
22 0.48
23 0.47
24 0.5
25 0.51
26 0.53
27 0.53
28 0.59
29 0.62
30 0.68
31 0.72
32 0.76
33 0.82
34 0.83
35 0.84
36 0.85
37 0.84
38 0.81
39 0.79
40 0.81
41 0.82
42 0.78
43 0.71
44 0.65
45 0.59
46 0.53
47 0.49
48 0.45
49 0.39
50 0.4
51 0.44
52 0.47
53 0.5
54 0.49
55 0.55
56 0.53
57 0.48
58 0.43
59 0.36
60 0.31
61 0.25
62 0.23
63 0.14
64 0.13
65 0.12
66 0.11
67 0.1
68 0.07
69 0.07
70 0.07
71 0.07
72 0.05
73 0.07
74 0.08
75 0.08
76 0.1
77 0.12
78 0.12
79 0.16
80 0.16
81 0.15
82 0.15
83 0.15
84 0.16
85 0.18
86 0.2
87 0.18
88 0.18
89 0.18
90 0.17
91 0.17
92 0.14
93 0.11
94 0.09
95 0.08
96 0.09
97 0.08
98 0.09
99 0.09
100 0.09
101 0.09
102 0.09
103 0.08
104 0.07
105 0.07
106 0.07
107 0.08
108 0.07
109 0.06
110 0.07
111 0.06
112 0.06
113 0.06
114 0.06
115 0.05
116 0.06
117 0.06
118 0.07
119 0.1
120 0.11
121 0.11
122 0.11
123 0.12
124 0.13
125 0.12
126 0.17
127 0.17
128 0.21
129 0.3
130 0.35
131 0.35
132 0.36
133 0.39
134 0.35
135 0.36
136 0.39
137 0.32
138 0.31
139 0.32
140 0.33
141 0.33
142 0.32
143 0.28
144 0.23
145 0.21
146 0.18
147 0.17
148 0.14
149 0.1
150 0.1
151 0.1
152 0.08
153 0.08
154 0.07
155 0.08
156 0.08