Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2G643

Protein Details
Accession A0A2I2G643   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-85VPKIRNRHIHFPRCVKKRKMKRKISPGFRESBasic
NLS Segment(s)
PositionSequence
69-81VKKRKMKRKISPG
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MLHITSYLHSHPAGNKQKDISKVGHILPQDCISRKQSNPAAIDTHTHTQISADQVPKIRNRHIHFPRCVKKRKMKRKISPGFRES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.44
4 0.48
5 0.5
6 0.5
7 0.42
8 0.37
9 0.38
10 0.36
11 0.35
12 0.31
13 0.28
14 0.26
15 0.27
16 0.24
17 0.22
18 0.24
19 0.26
20 0.3
21 0.29
22 0.35
23 0.35
24 0.38
25 0.38
26 0.36
27 0.33
28 0.28
29 0.29
30 0.25
31 0.22
32 0.17
33 0.15
34 0.13
35 0.12
36 0.13
37 0.16
38 0.16
39 0.16
40 0.17
41 0.2
42 0.24
43 0.29
44 0.31
45 0.33
46 0.38
47 0.41
48 0.5
49 0.57
50 0.64
51 0.66
52 0.73
53 0.77
54 0.78
55 0.83
56 0.82
57 0.83
58 0.85
59 0.89
60 0.89
61 0.9
62 0.92
63 0.93
64 0.94
65 0.94