Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2G6I7

Protein Details
Accession A0A2I2G6I7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-29PEQGRSQIKPKEKKRRFCTQKCLLGLRRRHydrophilic
NLS Segment(s)
PositionSequence
11-14KEKK
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
Amino Acid Sequences PEQGRSQIKPKEKKRRFCTQKCLLGLRRRSTLDDNCPNVALHRGEDNSKFHLTNTTGLIRLLKDQLDRDVNCIKPMAGCGSAGAPFKITCERFGYTVVGKGTTCYVWPQVSAEEDVYRVLASLQGSVVPVFLGKIDLEKSYFLLEVGDVRHMLLMSYGGDTIMAADIDPWVRDEKVEEAVASISSLGVRHRDLHSANILWNKELREVMIIDFNLSELSPEVATKKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.89
4 0.89
5 0.89
6 0.87
7 0.87
8 0.82
9 0.83
10 0.8
11 0.79
12 0.78
13 0.73
14 0.69
15 0.62
16 0.61
17 0.59
18 0.59
19 0.59
20 0.59
21 0.58
22 0.53
23 0.51
24 0.46
25 0.39
26 0.36
27 0.27
28 0.2
29 0.2
30 0.2
31 0.23
32 0.27
33 0.29
34 0.28
35 0.3
36 0.29
37 0.25
38 0.29
39 0.27
40 0.26
41 0.27
42 0.24
43 0.22
44 0.22
45 0.23
46 0.18
47 0.18
48 0.18
49 0.16
50 0.16
51 0.17
52 0.21
53 0.27
54 0.26
55 0.28
56 0.32
57 0.3
58 0.29
59 0.28
60 0.23
61 0.17
62 0.18
63 0.16
64 0.11
65 0.1
66 0.1
67 0.1
68 0.13
69 0.13
70 0.12
71 0.1
72 0.09
73 0.11
74 0.16
75 0.16
76 0.15
77 0.18
78 0.19
79 0.19
80 0.21
81 0.21
82 0.16
83 0.19
84 0.17
85 0.15
86 0.13
87 0.13
88 0.13
89 0.1
90 0.1
91 0.08
92 0.1
93 0.09
94 0.09
95 0.1
96 0.09
97 0.1
98 0.11
99 0.1
100 0.08
101 0.08
102 0.08
103 0.07
104 0.06
105 0.05
106 0.04
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.06
113 0.06
114 0.06
115 0.04
116 0.04
117 0.03
118 0.04
119 0.04
120 0.04
121 0.05
122 0.06
123 0.07
124 0.08
125 0.08
126 0.09
127 0.09
128 0.09
129 0.08
130 0.07
131 0.06
132 0.07
133 0.08
134 0.08
135 0.07
136 0.07
137 0.08
138 0.07
139 0.07
140 0.06
141 0.05
142 0.05
143 0.06
144 0.06
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.04
151 0.03
152 0.04
153 0.05
154 0.05
155 0.06
156 0.06
157 0.08
158 0.08
159 0.09
160 0.1
161 0.12
162 0.15
163 0.15
164 0.14
165 0.13
166 0.14
167 0.13
168 0.12
169 0.09
170 0.06
171 0.06
172 0.06
173 0.07
174 0.09
175 0.11
176 0.14
177 0.16
178 0.22
179 0.23
180 0.26
181 0.3
182 0.29
183 0.32
184 0.34
185 0.34
186 0.3
187 0.31
188 0.29
189 0.27
190 0.26
191 0.23
192 0.19
193 0.19
194 0.19
195 0.22
196 0.2
197 0.18
198 0.17
199 0.16
200 0.14
201 0.13
202 0.12
203 0.07
204 0.09
205 0.08
206 0.1
207 0.13