Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FY02

Protein Details
Accession A0A2I2FY02    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-29ATQSEKKRFPLPRLRNPRKAKRSSVRALHydrophilic
NLS Segment(s)
PositionSequence
7-24KKRFPLPRLRNPRKAKRS
Subcellular Location(s) mito 15, nucl 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MATQSEKKRFPLPRLRNPRKAKRSSVRALAWLCDVCRADLCPRALFNIVTPCCTPIGTLLRGWMGMYSHYLNRMF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.86
4 0.89
5 0.91
6 0.9
7 0.87
8 0.86
9 0.84
10 0.84
11 0.8
12 0.78
13 0.68
14 0.64
15 0.57
16 0.48
17 0.4
18 0.32
19 0.25
20 0.2
21 0.19
22 0.13
23 0.12
24 0.13
25 0.13
26 0.17
27 0.18
28 0.16
29 0.16
30 0.17
31 0.18
32 0.17
33 0.17
34 0.21
35 0.2
36 0.21
37 0.21
38 0.21
39 0.2
40 0.2
41 0.18
42 0.14
43 0.19
44 0.18
45 0.18
46 0.19
47 0.19
48 0.19
49 0.19
50 0.15
51 0.1
52 0.1
53 0.13
54 0.15
55 0.16