Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FVD9

Protein Details
Accession A0A2I2FVD9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
63-87NGRTAFCKCKFKKCAKDGNKCHFDSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, cyto 1, pero 1, E.R. 1, golg 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR023112  Antifungal-protein_dom_sf  
IPR022706  Antifungal_prot  
Gene Ontology GO:0050832  P:defense response to fungus  
Pfam View protein in Pfam  
PF11402  Antifungal_prot  
Amino Acid Sequences MKFLSIASLSLILFTAMGVLGSPIESEALASNDLDARDEAGILIKYPGTCSKKNNNCRYKSQNGRTAFCKCKFKKCAKDGNKCHFDSYNQDCQCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.04
4 0.04
5 0.03
6 0.03
7 0.03
8 0.04
9 0.04
10 0.03
11 0.04
12 0.04
13 0.04
14 0.05
15 0.06
16 0.07
17 0.06
18 0.07
19 0.08
20 0.08
21 0.09
22 0.08
23 0.07
24 0.07
25 0.07
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.07
34 0.14
35 0.17
36 0.19
37 0.25
38 0.35
39 0.44
40 0.54
41 0.64
42 0.66
43 0.66
44 0.72
45 0.75
46 0.75
47 0.76
48 0.74
49 0.71
50 0.67
51 0.66
52 0.62
53 0.62
54 0.6
55 0.56
56 0.59
57 0.54
58 0.6
59 0.66
60 0.72
61 0.74
62 0.75
63 0.8
64 0.8
65 0.88
66 0.88
67 0.9
68 0.87
69 0.78
70 0.73
71 0.65
72 0.58
73 0.55
74 0.53
75 0.53