Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2G987

Protein Details
Accession A0A2I2G987    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-41GQDTRQDSRRDTRRRRGHRKSQFAVSHydrophilic
NLS Segment(s)
PositionSequence
28-35RRRRGHRK
Subcellular Location(s) nucl 9.5, cyto_nucl 7, mito 6, cyto 3.5, extr 3, plas 2, cysk 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVSFLLGYEGLPVIGGQDTRQDSRRDTRRRRGHRKSQFAVSWLFPSLSFSLSLSPSPMILGPAVDGGQGSKVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.11
5 0.15
6 0.17
7 0.22
8 0.23
9 0.25
10 0.35
11 0.45
12 0.5
13 0.56
14 0.65
15 0.71
16 0.8
17 0.88
18 0.89
19 0.9
20 0.89
21 0.9
22 0.83
23 0.79
24 0.69
25 0.6
26 0.52
27 0.41
28 0.33
29 0.23
30 0.2
31 0.13
32 0.14
33 0.13
34 0.11
35 0.11
36 0.1
37 0.11
38 0.12
39 0.12
40 0.11
41 0.11
42 0.1
43 0.1
44 0.1
45 0.09
46 0.08
47 0.08
48 0.07
49 0.08
50 0.08
51 0.07
52 0.07
53 0.06