Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FQW6

Protein Details
Accession A0A2I2FQW6   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
245-276VPLRPTGSGFRQRRRTPKTPRRGSRKPEEGTVHydrophilic
NLS Segment(s)
PositionSequence
183-271GHPPARRRPPRGPHEGAWAGEGSRGKNPGCRLPRRHPQVAPRWPTGPAPGQTAKPPVRPGEWVPLRPTGSGFRQRRRTPKTPRRGSRKP
Subcellular Location(s) mito 13, nucl 6, cyto 4, extr 2
Family & Domain DBs
Amino Acid Sequences PIYPPPYSPLFPPGPLRAPTGLAVGHPRSIRPGTRPPPDLLPQAPDRPRAFSVRRPPTPDLLPQAPDRPRAFCPGHHTPRTVLPRDLGRSHHVITPTRPPKAPSRANWSASGPLSRTSPLPARHHPPPCILPKPPPRQLVWRWATPGPFDQAPDHPRTAPVPFRSGAHPPRTFCPRPLARQEGHPPARRRPPRGPHEGAWAGEGSRGKNPGCRLPRRHPQVAPRWPTGPAPGQTAKPPVRPGEWVPLRPTGSGFRQRRRTPKTPRRGSRKPEEGTVVSGRRLAYPVPFPPLQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.43
4 0.37
5 0.36
6 0.34
7 0.3
8 0.25
9 0.2
10 0.25
11 0.22
12 0.25
13 0.24
14 0.23
15 0.27
16 0.31
17 0.33
18 0.34
19 0.43
20 0.47
21 0.54
22 0.58
23 0.55
24 0.57
25 0.58
26 0.57
27 0.48
28 0.45
29 0.42
30 0.47
31 0.48
32 0.48
33 0.45
34 0.44
35 0.45
36 0.47
37 0.47
38 0.47
39 0.55
40 0.57
41 0.62
42 0.64
43 0.65
44 0.62
45 0.61
46 0.58
47 0.54
48 0.47
49 0.44
50 0.39
51 0.44
52 0.42
53 0.45
54 0.42
55 0.38
56 0.37
57 0.41
58 0.41
59 0.36
60 0.41
61 0.44
62 0.52
63 0.51
64 0.51
65 0.45
66 0.52
67 0.56
68 0.52
69 0.43
70 0.37
71 0.39
72 0.42
73 0.42
74 0.37
75 0.33
76 0.33
77 0.33
78 0.33
79 0.3
80 0.28
81 0.29
82 0.37
83 0.38
84 0.38
85 0.37
86 0.37
87 0.43
88 0.5
89 0.54
90 0.48
91 0.52
92 0.56
93 0.57
94 0.56
95 0.49
96 0.44
97 0.37
98 0.34
99 0.25
100 0.19
101 0.18
102 0.16
103 0.15
104 0.14
105 0.19
106 0.24
107 0.29
108 0.32
109 0.36
110 0.44
111 0.48
112 0.47
113 0.45
114 0.44
115 0.45
116 0.44
117 0.41
118 0.42
119 0.48
120 0.54
121 0.57
122 0.55
123 0.51
124 0.54
125 0.55
126 0.57
127 0.5
128 0.44
129 0.4
130 0.38
131 0.36
132 0.3
133 0.28
134 0.2
135 0.17
136 0.16
137 0.14
138 0.17
139 0.2
140 0.22
141 0.21
142 0.19
143 0.2
144 0.2
145 0.21
146 0.22
147 0.21
148 0.21
149 0.2
150 0.21
151 0.23
152 0.29
153 0.32
154 0.35
155 0.36
156 0.35
157 0.38
158 0.46
159 0.44
160 0.39
161 0.43
162 0.4
163 0.43
164 0.49
165 0.51
166 0.43
167 0.49
168 0.54
169 0.54
170 0.56
171 0.57
172 0.55
173 0.56
174 0.66
175 0.66
176 0.66
177 0.66
178 0.69
179 0.7
180 0.75
181 0.73
182 0.64
183 0.66
184 0.61
185 0.51
186 0.42
187 0.34
188 0.25
189 0.22
190 0.21
191 0.14
192 0.14
193 0.17
194 0.16
195 0.2
196 0.23
197 0.3
198 0.37
199 0.45
200 0.51
201 0.57
202 0.67
203 0.71
204 0.76
205 0.72
206 0.73
207 0.75
208 0.76
209 0.73
210 0.67
211 0.6
212 0.54
213 0.5
214 0.45
215 0.41
216 0.33
217 0.33
218 0.32
219 0.32
220 0.33
221 0.41
222 0.4
223 0.38
224 0.4
225 0.37
226 0.37
227 0.39
228 0.4
229 0.42
230 0.45
231 0.44
232 0.43
233 0.46
234 0.45
235 0.41
236 0.4
237 0.35
238 0.36
239 0.43
240 0.48
241 0.51
242 0.6
243 0.68
244 0.76
245 0.8
246 0.82
247 0.83
248 0.86
249 0.88
250 0.89
251 0.91
252 0.91
253 0.91
254 0.91
255 0.9
256 0.89
257 0.82
258 0.77
259 0.73
260 0.65
261 0.6
262 0.59
263 0.51
264 0.42
265 0.4
266 0.35
267 0.29
268 0.29
269 0.25
270 0.23
271 0.26
272 0.29
273 0.33