Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8LVF4

Protein Details
Accession B8LVF4    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
172-194RMSLEGKKKTEKREKGNDEEEGKBasic
NLS Segment(s)
PositionSequence
177-187GKKKTEKREKG
Subcellular Location(s) mito 16.5, cyto_mito 10.5, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000456  Ribosomal_L17  
IPR036373  Ribosomal_L17_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01196  Ribosomal_L17  
PROSITE View protein in PROSITE  
PS01167  RIBOSOMAL_L17  
Amino Acid Sequences MAGGAAKYRHLSRKSSHRQALLRNLVTSLIKHESITTTWPKAKEAQRLAEKLITLGKRNTEHARRRAQSIFYTPHELLPKLFGPLRDRYAERQGGYTRVLRVEPKKDDQAPSAILELVDGPKDMRFAITAKAIARQREQGIQTLNELTALNVKKVTRYRKGGVEALEKEIERMSLEGKKKTEKREKGNDEEEGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.71
4 0.7
5 0.73
6 0.75
7 0.78
8 0.76
9 0.68
10 0.58
11 0.51
12 0.45
13 0.4
14 0.32
15 0.27
16 0.21
17 0.19
18 0.19
19 0.19
20 0.19
21 0.19
22 0.25
23 0.25
24 0.26
25 0.3
26 0.31
27 0.32
28 0.38
29 0.43
30 0.47
31 0.47
32 0.51
33 0.54
34 0.55
35 0.55
36 0.49
37 0.43
38 0.35
39 0.35
40 0.28
41 0.24
42 0.24
43 0.26
44 0.26
45 0.3
46 0.37
47 0.41
48 0.48
49 0.53
50 0.6
51 0.57
52 0.61
53 0.6
54 0.55
55 0.49
56 0.46
57 0.43
58 0.36
59 0.4
60 0.34
61 0.34
62 0.33
63 0.3
64 0.24
65 0.22
66 0.2
67 0.16
68 0.17
69 0.16
70 0.17
71 0.21
72 0.23
73 0.23
74 0.24
75 0.26
76 0.32
77 0.33
78 0.29
79 0.29
80 0.27
81 0.26
82 0.26
83 0.24
84 0.18
85 0.16
86 0.17
87 0.18
88 0.21
89 0.25
90 0.27
91 0.29
92 0.33
93 0.35
94 0.36
95 0.34
96 0.32
97 0.27
98 0.23
99 0.2
100 0.15
101 0.12
102 0.1
103 0.1
104 0.08
105 0.06
106 0.06
107 0.05
108 0.05
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.09
115 0.11
116 0.13
117 0.13
118 0.19
119 0.22
120 0.23
121 0.24
122 0.27
123 0.27
124 0.3
125 0.31
126 0.29
127 0.29
128 0.27
129 0.27
130 0.24
131 0.22
132 0.17
133 0.16
134 0.12
135 0.16
136 0.16
137 0.15
138 0.17
139 0.17
140 0.22
141 0.29
142 0.38
143 0.4
144 0.46
145 0.5
146 0.54
147 0.59
148 0.57
149 0.55
150 0.55
151 0.49
152 0.46
153 0.44
154 0.37
155 0.33
156 0.29
157 0.24
158 0.16
159 0.15
160 0.14
161 0.19
162 0.24
163 0.3
164 0.34
165 0.43
166 0.49
167 0.59
168 0.67
169 0.69
170 0.74
171 0.79
172 0.84
173 0.83
174 0.83
175 0.8