Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2GJU2

Protein Details
Accession A0A2I2GJU2    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKSCLPIKWPRYHRRKTPDANAKNTQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 12.833, mito 11.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MKSCLPIKWPRYHRRKTPDANAKNTQMPMQILIYTNKSHHNHDVIILSTMSITSDINRSGYHPGVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.86
3 0.85
4 0.85
5 0.86
6 0.82
7 0.81
8 0.76
9 0.7
10 0.63
11 0.55
12 0.45
13 0.36
14 0.28
15 0.22
16 0.17
17 0.14
18 0.12
19 0.13
20 0.14
21 0.13
22 0.14
23 0.2
24 0.21
25 0.24
26 0.26
27 0.27
28 0.26
29 0.27
30 0.27
31 0.2
32 0.2
33 0.16
34 0.13
35 0.1
36 0.1
37 0.08
38 0.07
39 0.06
40 0.06
41 0.09
42 0.1
43 0.12
44 0.12
45 0.14
46 0.19