Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2G9Q6

Protein Details
Accession A0A2I2G9Q6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-21RMNKVQCRRVGERMRRRGLKBasic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
Pfam View protein in Pfam  
PF00856  SET  
Amino Acid Sequences MRMNKVQCRRVGERMRRRGLKVAEVHYEMPNAKSKLSERININHTCDPNVKAKIIHRRQVMIARRRICKQQEVRYIHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.8
4 0.77
5 0.75
6 0.68
7 0.65
8 0.6
9 0.54
10 0.48
11 0.45
12 0.44
13 0.36
14 0.34
15 0.27
16 0.23
17 0.25
18 0.21
19 0.18
20 0.18
21 0.19
22 0.26
23 0.28
24 0.31
25 0.28
26 0.32
27 0.37
28 0.38
29 0.41
30 0.36
31 0.33
32 0.31
33 0.3
34 0.28
35 0.29
36 0.29
37 0.25
38 0.24
39 0.3
40 0.39
41 0.44
42 0.49
43 0.45
44 0.46
45 0.48
46 0.55
47 0.58
48 0.56
49 0.57
50 0.57
51 0.6
52 0.62
53 0.67
54 0.64
55 0.65
56 0.65
57 0.67
58 0.7