Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FX98

Protein Details
Accession A0A2I2FX98    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
28-72GDEFRTTKKDKRQIKHNSFMSKIEKNSQKSAKRRRSSKKLAANLDHydrophilic
NLS Segment(s)
PositionSequence
38-40KRQ
42-42K
48-66SKIEKNSQKSAKRRRSSKK
102-114KPGAMKRREKLEK
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MAPIRSVKKQAATKKPTAAAAPQSGIFGDEFRTTKKDKRQIKHNSFMSKIEKNSQKSAKRRRSSKKLAANLDSLADALPEADEFNDPDSQVKVIKQTTLRHKPGAMKRREKLEKSERDRFAKNMAQMSGMEAAATTNAGSEGDSGAGSSRWAALRSFISQTMEHQPAFKANK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.68
3 0.63
4 0.57
5 0.52
6 0.47
7 0.43
8 0.38
9 0.31
10 0.28
11 0.25
12 0.23
13 0.18
14 0.12
15 0.11
16 0.13
17 0.13
18 0.15
19 0.19
20 0.22
21 0.29
22 0.39
23 0.46
24 0.52
25 0.59
26 0.67
27 0.75
28 0.8
29 0.83
30 0.8
31 0.78
32 0.7
33 0.68
34 0.64
35 0.58
36 0.51
37 0.49
38 0.49
39 0.47
40 0.52
41 0.55
42 0.57
43 0.62
44 0.71
45 0.73
46 0.75
47 0.81
48 0.83
49 0.85
50 0.86
51 0.86
52 0.85
53 0.82
54 0.79
55 0.72
56 0.63
57 0.53
58 0.43
59 0.33
60 0.24
61 0.15
62 0.09
63 0.06
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.04
70 0.04
71 0.06
72 0.06
73 0.06
74 0.07
75 0.07
76 0.08
77 0.08
78 0.09
79 0.11
80 0.11
81 0.14
82 0.17
83 0.23
84 0.33
85 0.42
86 0.44
87 0.43
88 0.45
89 0.5
90 0.55
91 0.59
92 0.58
93 0.57
94 0.57
95 0.66
96 0.71
97 0.65
98 0.65
99 0.66
100 0.67
101 0.67
102 0.73
103 0.69
104 0.67
105 0.67
106 0.59
107 0.55
108 0.49
109 0.45
110 0.4
111 0.34
112 0.3
113 0.27
114 0.28
115 0.23
116 0.17
117 0.13
118 0.09
119 0.09
120 0.07
121 0.07
122 0.05
123 0.03
124 0.04
125 0.04
126 0.04
127 0.05
128 0.05
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.08
137 0.09
138 0.11
139 0.11
140 0.14
141 0.17
142 0.2
143 0.23
144 0.23
145 0.25
146 0.24
147 0.28
148 0.33
149 0.33
150 0.3
151 0.29
152 0.28