Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2GQ65

Protein Details
Accession A0A2I2GQ65    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MHDLRVPGKRCGNRKKKRKEKKSYRARKEKNAAQDYBasic
NLS Segment(s)
PositionSequence
9-30KRCGNRKKKRKEKKSYRARKEK
Subcellular Location(s) mito 7plas 7, E.R. 4, golg 3, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHDLRVPGKRCGNRKKKRKEKKSYRARKEKNAAQDYVFFFLFFFFSFIFFLFQIALLVAPPDTACCISDAYGSWNLIGGRCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.87
3 0.89
4 0.93
5 0.94
6 0.95
7 0.95
8 0.95
9 0.96
10 0.96
11 0.95
12 0.95
13 0.92
14 0.91
15 0.88
16 0.83
17 0.82
18 0.76
19 0.66
20 0.56
21 0.53
22 0.44
23 0.37
24 0.31
25 0.2
26 0.15
27 0.14
28 0.13
29 0.08
30 0.07
31 0.05
32 0.06
33 0.06
34 0.07
35 0.08
36 0.07
37 0.08
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.06
50 0.07
51 0.07
52 0.08
53 0.09
54 0.09
55 0.11
56 0.11
57 0.14
58 0.17
59 0.17
60 0.16
61 0.18
62 0.18