Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2G1N1

Protein Details
Accession A0A2I2G1N1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-63NDLESIKKKPKKQGREKKKICKPKKGRNLLYSSBasic
NLS Segment(s)
PositionSequence
37-57KKKPKKQGREKKKICKPKKGR
Subcellular Location(s) nucl 13, mito 10, cyto 2
Family & Domain DBs
Amino Acid Sequences MHPSLASVSLCATGLPSRGNLSNELKRIHSNDLESIKKKPKKQGREKKKICKPKKGRNLLYSSPCTSKTVWHFYSTFRSVLRTSGTNFSWIFSSKCLVDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.14
5 0.17
6 0.19
7 0.23
8 0.28
9 0.32
10 0.36
11 0.36
12 0.36
13 0.36
14 0.37
15 0.37
16 0.32
17 0.28
18 0.3
19 0.34
20 0.37
21 0.35
22 0.38
23 0.44
24 0.47
25 0.5
26 0.54
27 0.58
28 0.64
29 0.73
30 0.79
31 0.8
32 0.86
33 0.9
34 0.91
35 0.91
36 0.91
37 0.88
38 0.88
39 0.87
40 0.86
41 0.87
42 0.87
43 0.84
44 0.8
45 0.8
46 0.75
47 0.71
48 0.64
49 0.57
50 0.49
51 0.43
52 0.37
53 0.3
54 0.3
55 0.3
56 0.34
57 0.32
58 0.34
59 0.33
60 0.34
61 0.42
62 0.38
63 0.34
64 0.26
65 0.28
66 0.25
67 0.27
68 0.27
69 0.22
70 0.23
71 0.26
72 0.26
73 0.28
74 0.27
75 0.26
76 0.25
77 0.24
78 0.22
79 0.18
80 0.21